|
|
Home
| Databases
| WorldLII
| Search
| Feedback
Malaysian Legislation |
LAWS OF MALAYSIA
RepRint
Act 518
nAtIOnAL LAnd cOde
(penAng And MALAccA
tItLeS) Act 1963
Incorporating all amendments up to 1 January 2006 published by
the CommissioneR of law Revision, malaysia
undeR the authoRity of the Revision of laws aCt 968 in CollaboRation with
peRCetakan nasional malaysia bhd
2006
nAtIOnAL LAnd cOde (penAng And MALAccA
tItLeS) Act 1963
first enacted ... ... ... ... ... ... ... 963 (act no. of 963)
Revised ... ... ... ... ... ... ... ... 994 (act 58 w.e.f. 7 april 994)
Previous rePrint
First Reprint ... ... ... ... ... 2002
3
LAWS OF MALAYSIA
Act 518
nAtIOnAL LAnd cOde (penAng And MALAccA
tItLeS) Act 1963
aRRanGement of seCtions
Part i
pReliminaRy
section
. short title
. application
3. (Omitted)
4. interpretation Part ii
administRation
Chapter 1--Areas and Officers
5. (Deleted)
6. appointment of officers
7. seals of office
8. protection of officers
9. powers of the director
0. powers of a land administrator Chapter 2--Land Titles Appeal Board
. land titles appeal board
. meetings of the board
3. proceedings of the board
4. power to appoint secretary, etc. 4 Laws of Malaysia Act 518
5. appeals
6. General powers of the board
7. orders of the board Chapter 3--Questions of Law
8. power to reserve question of law for Court
9. appeals on points of law Chapter 4-- General
0. evidence at enquiries, etc. . Review of orders of the director and the board
. Cesser of powers upon indefeasibility
3. (Deleted) Part iii
the inteRim ReGisteR
Chapter 1--General
4. provision relating to malacca Chapter 2--Holdings
5. powers of the director relating to holdings
6. limitations on powers of the director
7. special provision relating to enquiries by the director
8. applications relating to boundaries of holdings
9. finality of certain boundaries
30. seashore and riverine holdings Chapter 3--Preparation and Maintenance of the Interim Register
3. director to prepare and maintain interim Register
3. interim Register to be a public document section
5National Land Code (Penang and Malacca Titles)
33. where the title to a holding is not clear
34. Correction of errors Part iv
ReplaCement title
Chapter 1--General
35. presumption relating to replacement title Chapter 2--Creation of Replacement Title
36. extinguishment and replacement of existing interests
37. General incidents of replacement title
38. Replacement title protected from adverse possession
39. Replacement titles
40. Grant (first grade)
4. Grant
4. state lease
43. mukim indication
44. title by adverse possession
45. Conditions, etc., of replacement titles
46. merger and division of titles
47. estates in absolute possession
48. leaseholds
49. mortgages, etc.
50. settled estates
5. easements and public rights of way
5. (Deleted) Chapter 3--Claims relating to Replacement Titles
53. presentation of claims
54. enquiry by director
55. Reference to Court section
6 Laws of Malaysia Act 518
Part v
effeCt of inteRim ReGistRation
Chapter 1--General
section
56. interpretation
57. Restrictions to bind proprietor
58. limitations of replacement title
59. saving for fraud, contractual rights, etc.
60. evidence of entries in interim Register Chapter 2--Leases
6. saving of pre-existing rights, etc. Chapter 3--Mortgages and Charges
6. saving of pre-existing rights, etc.
63. priorities of mortgages
64. procedure on exercise of power of sale, etc.
65. discharge of mortgage or charge Chapter 4--Trusts and Settlements
66. trusts generally excluded from interim Register
67. pre-existing trusts, etc., to continue
68. where person entitled to be registered as proprietor is an infant
69. Registration "as trustee"
70. act not to affect powers under certain laws Chapter 5--Easements and Restrictive Covenants
7. Registration of easements
7. (Deleted)
73. public rights of way
74. (Deleted) 7National Land Code (Penang and Malacca Titles)
Part vi
dealinGs on the inteRim ReGisteR
section
75. (Deleted)
76. effect of registration
77. pre-executed instruments
78. instruments to be in prescribed form
79. saving
80. duties of director
8. procedure relating to registration
8. dealings prior to indefeasibility
83. dealings after indefeasibility Part vii
indefeasibility of title
Chapter 1--Investigation of Title
84. examination of title by the director
85. indefeasibility after twelve months' notice
86. minors and persons of unsound mind
87. examination of title at the instance of a proprietor
88. indefeasibility after twelve years on interim Register Chapter 2--Certificates of Title
89. Certificate of indefeasibility
90. Cancellation of pre-existing deeds
9. Release of documents of historic interest
9. advance certificate of title
93. final documents of title Part viii
pRovisions RelatinG to malaCCa
Chapter 1--Preliminary
94. interpretation 8 Laws of Malaysia Act 518
95. application
96. Repeal
97. special provision relating to the naning Custom
98. finality of certain boundaries Chapter 2--Application of the National Land Code
99. effect of repealing the ordinance
00. saving relating to incomplete proceedings
0. Rent
0. malacca Customary land Register
03. mortgages of customary land Chapter 3--Certificated Lands
04. state authority may declare a person to be a certificated person
05. Certificated land
06. when land ceases to be certificated land Chapter 4--Restrictions in Use and Interest
07. (Deleted)
08. limitation 08a. liability of land to forfeiture where a malacca Customary land company ceases to be such
08b. summary action to secure restoration of the status of a malacca Customary land company
08c. action to enforce forfeiture
08d. forfeiture to take effect upon notification in the Gazette
09. Right of re-entry 09a. application for endorsement of title as malacca Customary land 09b. effect of re-entry
09c. effect of surrender
section
9National Land Code (Penang and Malacca Titles)
Part iX
natuRal RiGhts
section
0. (Deleted) . (Deleted)
. special rights of certain riparian proprietors
Part X
GeneRal
3. offences and penalties
4. Rules
5. service of notices, etc.
6. saving of rights of land administrator, etc.
7. surveys to be free of charge
8. Repeal
9. power of the minister to make orders
0. searches . title in continuation and procedure on subdivision . provision relating to state land, municipal streets, etc.
3. transitional provisions relating to certain mortgages, etc.
4. transitional provision relating to subdivision of certain lands First schedule
second schedule (Deleted)
third schedule
Fourth schedule
FiFth schedule
sixth schedule
seventh schedule
0 Laws of Malaysia Act 518
National Land Code (Penang and Malacca Titles)
LAWS OF MALAYSIA
Act 518
nAtIOnAL LAnd cOde (penAng And MALAccA
tItLeS) Act 1963
an act to provide for the introduction of a system of registration of title to land in the states of penang and malacca, for the issue of replacement titles, for the assimilation of such system to the national land Code, and for matters incidental thereto. [1 January 1966, L.N. 475/1965]
wheReas it is desired to introduce in the form of a national land Code a uniform land system within all the states of malaya: and wheReas it is in consequence necessary for the purpose of ensuring uniformity of law and policy to introduce into the states of penang and malacca a system of registration of title to land and other provisions incidental thereto consonant with the provisions of a national land Code:
now, theRefoRe, pursuant to the provisions of Clause (4) of article 76 of the Constitution Be It enActed by the seri paduka baginda yang di-pertuan agong with the advice and consent of the dewan negara and dewan Rakyat in parliament assembled, and by the authority of the same, as follows: Part i
pReliminaRy
Short title
1. this act may be cited as the national land Code (penang and malacca titles) act 963.
Laws of Malaysia Act 518
Application
2. () this act shall apply to the states of penang and malacca.
() nothing in this act shall be deemed to affect any law relating to the imposition or levy by the Government of the federation or the state or by any local authority of any taxes, duties, rates, charges or other outgoings on land, or to any encroachment on state lands, or to drainage works and irrigation areas, for the time being in force in the state, nor shall anything herein (other than section 97) be deemed to affect the custom called the naning Custom.
3. (Omitted). Interpretation
4. () in this act, unless the context otherwise requires-- *"appointed day" means the day appointed by the minister under section 3;
"board" means the land titles appeal board established under section ;
"director" means the director of land titles appointed under section 6, and includes a deputy director ;
"country land" has the same meaning as in the national land Code [Act 56 of 1965];
"Court" means the high Court in malaya;
"dealing" means any transaction of whatever nature by which any land is affected;
"deputy director" means a deputy director of land titles appointed under section 6;
"director of survey" means the director of survey of the state, and in relation to any time prior to the creation of the office of director of survey includes any officer who was then exercising in the state the powers of the director of survey; *NOTE--the appointed day is January 966 vide l.n. 475/965. 3National Land Code (Penang and Malacca Titles)
"document of original title" means the original grant, indenture, lease or other instrument made by the dutch authorities, the east india Company, the Crown or the state, as the case may be, from which the pre-existing title to a holding or part of a holding descends or is presumed to descend;
"estate in land" includes any title to land, any right thereunder, and any right subsisting under a replacement lease or replacement mortgage or charge;
"form" means any form prescribed in the first schedule; "holding" means a piece of land (not being mining land or state land) duly surveyed under this or any other written law for the time being in force in the state and on the appointed day being delineated on a plan certified by or on behalf of the director of survey as a lot or lots delimited, except as otherwise provided in sections 9 and 30, by right-line boundaries;
"interest" in relation to land means any interest in land recognised as such by law, and includes an estate in land;
"interim Register" means the register prepared and maintained under Chapter 3 of part iii;
"land administrator" means any land administrator or deputy or assistant land administrator appointed for the state or any district thereof;
"mining land" has the same meaning as in the national land Code;
"mukim indication" means words endorsed on the interim Register under section 43;
"pre-existing" means, generally, in existence immediately before and not having lapsed or expired before the appointed day; "pre-existing deeds" means all deeds, documents of original title and instruments of any kind whatsoever evidencing or purporting to evidence any pre-existing interests;
4 Laws of Malaysia Act 518
"pre-existing interests" means all interests, rights, titles and estates (not being interests, rights, titles or estates vested in the yang di-pertua negeri or the Government of the state) subsisting immediately before the appointed day in any land in the state, including any title therein acquired by adverse possession or operation of law or under any unregistered pre-existing deed; "purchaser" means a person who in good faith and for valuable consideration acquires an interest in land, and includes a mortgagee, chargee and lessee;
"registered" means, generally, registered under this act or, in relation to the period preceding the appointed day, registered under the Registration of deeds ordinance [S.S. Cap. 121] or the mutations in titles to land ordinance [S.S. Cap. 126]; "replacement lease" means a lease endorsed upon a replacement title in the interim Register in replacement of a pre-existing lease;
"replacement mortgage" or "replacement charge" means a charge endorsed upon a replacement title in the interim Register in replacement of a pre-existing mortgage or charge, as the case may be;
"replacement title" or "replacement interest" means a title or interest, as the case may be, in any holding to which any person is entitled under, and which has been entered, on the interim Register in accordance with part iv;
"river" includes any stream, channel or watercourse; "settlement" and "settled estate" have the meanings respectively assigned thereto by section of the settled estates ordinance [S.S. Cap. 52];
"state" means the state of malacca or the state of penang, as the circumstances may require;
5National Land Code (Penang and Malacca Titles)
"state land" has the same meaning as in the national land Code;
"trust" and "trust for sale" have the meanings respectively assigned thereto by section 3 of the trustee act 949 [Act 208]; () all words and expressions defined in any pre-existing law relating to land in the state shall, to such extent as they shall not be inconsistent with this act or the national land Code, retain the meanings assigned to them by such law.
(3) (Deleted by Act 55 of 1965).
Part ii
administRation
Chapter 1--Areas and Officers
5. (Deleted by Act 55 of 1965). Appointment of officers
6. () the yang di-pertuan agong may appoint for each state a director of land titles, and one or more deputy directors of land titles, as he may consider necessary for the due execution of this act.
() (Deleted by Act 55 of 1965).
(3) subject to any rules made under section 4, the director shall have the general direction and control of all officers appointed under subsection ().
(4) every officer appointed under this section shall be deemed to be a public servant within the meaning of the penal Code [Act 574].
Seals of office
7. every officer appointed under section 6 shall have and may use a seal of office inscribed with the title of his office; and every 6 Laws of Malaysia Act 518
instrument bearing the imprint of such seal and purporting to be signed or issued by such officer shall be received in evidence and, unless the contrary intention be shown, shall be deemed without further proof to be issued by or under the direction of the director.
protection of officers
8. no action, suit or proceeding shall lie against any officer appointed under section 6 for anything done or omitted to be done by him in good faith in the intended exercise of any power or performance of any duty provided or imposed by this act. powers of the director
9. () the director and the deputy director shall have and may exercise the following powers:
(a) for the purposes of this act to enter upon and have free access to any land in the state, and to make enquiries and to do or cause to be done all things necessary for effecting the survey demarcation of the boundaries of any such land;
(b) for the purpose of satisfying himself of the validity of any title or interest in land, or for any purpose of this act, to call upon the holder (including a mortgagee, lessee or any other person who may have an interest in land) of any title or interest in land, or any class or description of such holders, to produce for inspection by him any document of original title or other deed or document in his or their possession, to require any person to give the director information as to the whereabouts of any deeds or documents or as to the person or persons in whose custody they may be, and to take copies of or extracts from such deeds or documents;
(c) for the purpose of deducing the title to any holding under this act, all the powers conferred upon and the benefit of all the assumptions entitled to be made by a purchaser of land under any pre-existing law;
(d) for the purposes of this act to conduct enquiries and to administer oaths and affirmations, to examine any 7National Land Code (Penang and Malacca Titles)
witness on oath or affirmation, to summon any person before him, to take and record the evidence of any such person, and to award costs to any person appearing and giving evidence before him;
(e) to enter caveats on behalf of any person under the disability of infancy or unsoundness of mind or absence from malaysia, or to prohibit the transfer of or any dealing with any land in any folio of the interim Register belonging or supposed to belong to any such person, and also to prohibit the dealing with any such land in any case in which it appears to him that an error has been made in the interim Register, or for the prevention of fraud or improper dealing:
provided that knowledge of the fact that land has been acquired or will be held by a proprietor acting in a fiduciary capacity shall not of itself be a ground for the entry of a caveat by the director;
(f) all other powers conferred upon him by this act, and all such powers ancillary or incidental thereto as may be reasonably necessary to carry out the purposes of this act.
() the director may by instrument under his hand and seal in form a, and subject to such conditions and restrictions as he may think fit, delegate to any land administrator all or any of the powers conferred on him by this act, and either generally or with respect to any specified holding:
provided that no such delegation shall affect the exercise of any such powers by the director.
(3) the director of survey and any other officer acting under his direction or control shall have all the powers conferred on the director by paragraph ()(a).
(4) without prejudice to any other power conferred upon him by this act, the director may in respect of the interim Register take all such action by way of making an endorsement, opening a new folio or otherwise as is necessary in his opinion to give effect in the Register to the operation of, or the exercise (by himself, the board, a Court or any other person or authority) of any power under, this act or any other written law. 8 Laws of Malaysia Act 518
(5) subject to this act, the director shall have in relation to each folio of the interim Register the same powers and duties as the Registrar has under the national land Code in relation to a register document of title.
powers of a Land Administrator
10. () the director and the deputy director shall be deemed to have all the powers conferred upon a land administrator by the national land Code.
() (Deleted by Act 55 of 1965).
Chapter 2--Land Titles Appeal Board
Land titles Appeal Board
11. () there shall be established a land titles appeal board for the state consisting of--
(a) a chairman, who shall be appointed by and shall hold office during the pleasure of the yang di-pertua negeri; (b) one member who shall be an advocate and solicitor resident and practising in the state;
(c) one member who shall be either a public officer with experience of land administration or a surveyor licensed under the licensed land surveyors act 958 [Act
458].
() the members of the board referred to in paragraphs ()(b) and (c) shall be appointed by the yang di-pertua negeri in such manner and shall hold office for such periods and subject to such conditions as the yang di-pertua negeri may determine. (3) the minister may, after consultation with the yang di- pertua negeri, by notification in the Gazette prescribe a scale of allowances for the chairman and other members of the board. Meetings of the Board
12. () the board shall meet at such times and such places as the chairman may appoint.
9National Land Code (Penang and Malacca Titles)
() the quorum at all meetings of the board shall be two members present.
(3) the member presiding at any meeting of the board shall have an original vote and also, if upon any question the votes shall be evenly divided, a casting vote.
(4) the board may make regulations for the conduct of its business.
proceedings of the Board
13. () the proceedings of the board shall be open to the public and minutes thereof, including a note of any oral evidence given before the board, shall be kept by the chairman or other member presiding.
() any person claiming to be interested in any proceedings before the board may apply to the board to be made a party thereto, and the board may in its discretion allow any such application.
(3) all summonses, orders and notices issued under the hand of the secretary of the board shall be deemed to be issued by the board.
(4) the proceedings of the board shall be judicial proceedings, and the members of the board shall be public servants, within the meaning of the penal Code.
power to appoint secretary, etc.
14. () the board may appoint a secretary and such other officers as from time to time shall appear to be necessary for the discharge of the functions of the board.
() the secretary shall not be a member of the board and shall not have any vote in its deliberations.
Appeals
15. any person who is aggrieved by any decision given by the director under this act may, unless such decision relates to a 0 Laws of Malaysia Act 518
matter in which the decision of the director is final, within one month therefrom appeal to the board by lodging with the secretary to the board an application in duplicate in form b. general powers of the Board
16. the board shall have and may exercise the following powers:
(a) all the powers conferred on the director by this part; (b) power to hear and determine any appeal lodged under section 5 and to make such order thereon as it may think just;
(c) power to award costs to parties in proceedings before the board:
provided that such costs shall not exceed in any case the costs which would be assessed in respect of such proceedings if they were brought in a sessions Court. Orders of the Board
17. () the board shall, before making any order under paragraph 6(b), give the director and any interested parties an opportunity of being heard, either personally or by advocate and solicitor, and of producing such evidence, oral or documentary, as seems relevant to the board.
() the director shall, in so far as any order of the board affects any entry in the interim Register, correct the interim Register accordingly:
provided that in making any such correction he shall not erase or render illegible the original words of the Register, and shall affix the date of the order and the date on which such correction was made, with his initials.
Chapter 3--Questions of Law
power to reserve question of law for court
18. () the director or the board may, at any stage of any enquiry or proceeding, reserve for the consideration of the Court National Land Code (Penang and Malacca Titles)
any question of law arising in such enquiry or proceeding, in the form of a special case, which shall--
(a) set out shortly the facts to which the law is to be applied and the question or questions of law to be determined; (b) be sent to the Chief Registrar, Registrar, deputy Registrar, senior assistant Registrar or assistant Registrar of the Court; and
(c) be set down for argument in such manner as the Court directs.
() when any question is referred to the Court under this section--
(a) the reference may be heard and disposed of by a Judge in chambers;
(b) the Court shall not give any opinion upon any such question unless it is satisfied that the director and all persons who in the opinion of the Court are likely to be immediately affected by such opinion have had an opportunity to appear and be heard thereon by the Court, either personally or by advocate and solicitor.
(3) the Court shall hear and determine the question or questions of law arising on any special case reserved under subsection () and shall thereupon remit the matter to the director or the chairman of the board with the opinion of the Court thereon; and such opinion shall be binding on the director or the board, as the case may be.
(4) the costs of the proceedings in the Court under this section shall be in the discretion of the Court and may be dealt with by the order of such Court:
provided that neither the director nor any member of the board shall be personally liable to any costs in respect thereof. (5) no appeal shall lie from an opinion of the Court on any special case reserved under subsection () except by leave of *the federal Court.
Appeals on points of law
19. () an appeal shall lie to the Court on a point of law from any decision of the board.
*NOTE--previously "the supreme Court"see section 46 of the Constitution (amendment) act 994 [Act A885].
Laws of Malaysia Act 518
() an appeal under subsection () may be brought by any party aggrieved by the decision of the board, or by the director, and shall be brought before the Court by means of a notice of appeal lodged within six weeks after the date on which the decision of the board was made.
(3) the procedure governing appeals to the Court under this section shall be the same as for appeals to the Court from decisions of sessions Courts in civil matters.
Chapter 4--General
evidence at enquiries, etc.
20. () in conducting any enquiry or proceeding under this act it shall not be necessary for the director or the board-- (a) to take down the evidence of any witness in any such enquiry or proceeding verbatim, unless requested to do so by such witness or by any other person appearing in the course of the same enquiry or proceeding, or if the director or the board, as the case may be, shall think it desirable to do so:
provided that the substance of such evidence shall be recorded;
(b) to put in writing any decision given or order made, except in a short and concise form, showing the reasons for arriving at such decision or order.
() the record of all evidence, whether oral or documentary, taken by the director or the board at any enquiry or proceeding under this act shall be made up in a separate file together with the decision or order of the director or the board thereon, and shall at all reasonable times, upon a written application in that behalf, be open to the inspection of any person interested in such enquiry, or his agent duly authorized thereto in writing; and such person or agent may, upon payment of such fees as may be prescribed, obtain copies thereof or extracts therefrom. 3National Land Code (Penang and Malacca Titles)
Review of orders of the director and the Board
21. a decision or order of the director or the board may be reviewed, varied or set aside by the director or the board, as the case may be, in any of the following cases:
(a) where the decision or order was made in consequence of any fraud, misrepresentation or mistake;
(b) where fresh evidence of a material nature, which could not by the exercise of reasonable diligence have been produced when the decision was given or the order was made, is available;
(c) when the decision or order was made in the absence of any necessary or proper party whose absence was not due to any default or neglect on his part; or
(d) when, in the opinion of the director or the board, as the case may be, substantial injustice has been occasioned by the decision or order.
cesser of powers upon indefeasibility
22. the powers conferred by this part upon the Court, the board, the director and any other officer shall cease to be exercisable in relation to any holding as soon as the replacement title thereto has become indefeasible pursuant to part vii.
23. (Deleted by Act 55 of 1965). Part iii
the inteRim ReGisteR
Chapter 1--General
provision relating to Malacca
24. no land or holding which immediately before the appointed day was subject to the malacca lands Customary Rights ordinance [S.S. Cap. 125] or to any title by entry in the mukim Register kept under section 5 of that ordinance, or to any mutation in 4 Laws of Malaysia Act 518
title to such customary rights, shall be entered in the interim Register, and no provisions of this act, other than this section and of parts i, ii, viii, iX and X, shall apply to any such land or holding.
Chapter 2--Holdings
powers of the director relating to holdings
25. for the purpose of ascertaining the boundaries of holdings and preparing and maintaining an interim Register under this part, the director shall have and may exercise (but without prejudice to the generality of the powers conferred on him by section 9) the following powers:
(a) to enter upon and investigate the boundaries of a holding and to order that such boundaries be confirmed or varied in accordance with this part;
(b) to inspect and take copies of all records, plans and other documents relating to such holdings available in the office of the director of survey, in the Registry of deeds, the registry of mutations of title, the land office, and any other public office in the state;
(c) where there is any dispute concerning the boundaries of a holding or where the director is in doubt concerning the correctness of any such boundary, to hold an enquiry in respect thereof in exercise of the powers conferred on him by part ii;
(d) to reject any application made to him under subsection 8() if he is satisfied that such application is frivolous or not well-founded.
Limitations on powers of the director
26. without prejudice to the generality of the powers conferred on him by this act, the director shall not be required, for the purpose of preparing the interim Register--
(a) to inspect any records, plans or documents other than those to which he has access under paragraph 5(b); or
5National Land Code (Penang and Malacca Titles)
(b) to deduce the title to any holding for a period of more than twelve years prior to the appointed day, or for a period extending further back than a grant or lease by the Crown or the state, whichever shall be the shorter: provided that nothing in this paragraph shall be deemed to prejudice the powers of the director to deduce a title to any holding for any period extending further back than any such period.
Special provision relating to enquiries by the director
27. () whenever in exercise of the powers conferred on him by paragraph 5(c) the director shall hold an enquiry, any person interested may appear before the director either personally or by an advocate and solicitor.
() where all the persons interested in any holding which is the subject of an enquiry under paragraph 5(c) are in agreement upon the matter in dispute, the director may make an order in accordance with such agreement:
provided that the director shall not make any order which is inconsistent with this act or the national land Code. (3) any order made in respect of any holding in any enquiry held by the director under this part shall be final and conclusive with respect to the area and boundaries of such holding and shall be binding upon all persons having or acquiring any interest therein and upon their successors in title.
(4) for the purposes of this section "person interested" includes any person whose name is recorded in the interim Register as a proprietor, lessee or chargee of any holding and any person who claims to be such a proprietor, lessee or chargee or who would under part iv be entitled to be so recorded.
Applications relating to boundaries of holdings
28. () subject to section 9, any person interested in any holding who claims that any boundary mark relating thereto is incorrectly placed may apply to the director in form C, specifying the grounds of his claim and the evidence in support thereof. 6 Laws of Malaysia Act 518
() where in exercise of the powers conferred on him by paragraph 5(d) the director shall reject any such claim, such rejection shall be final and conclusive.
(3) where the director is satisfied that the claimant has a prima facie case he shall proceed to hold an enquiry under this act.
Finality of certain boundaries
29. () where the boundary of any holding has been or is deemed to have been finally ascertained or confirmed under the boundaries and survey maps ordinance [S.S. Cap. 130], the malacca Re-surveys ordinance [S.S. Cap. 132] or the penang Corrected Re-surveys ordinance 950 [Ord. 57 of 1950], such boundary shall be deemed for the purposes of this part to be final and conclusive and shall not be called in question in any proceedings under this act.
() where the proprietor or mortgagee of any holding or any of his predecessors in title has, by any conveyance or other instrument or in any enquiry under this act, dealt with or accepted the boundaries of such holdings as surveyed on the appointed day such boundary shall be deemed for the purposes of this part to be final and conclusive and shall not be called in question in any proceedings under this act.
(3) nothing in this section shall apply to any land in the state of malacca held under any title expressed as extending to a boundary commonly known as a "redline boundary", or to any land which has been conveyed or dealt with according to such a boundary; and the true boundary of any such land and any adjacent land to which such boundary is common shall be that which has been surveyed on the ground by or on behalf of the director of survey.
Seashore and riverine holdings
30. () where the boundaries of a holding abutting on any part of the foreshore or the bank of any river have not been surveyed by right-lines immediately before the appointed day, then such boundaries shall be deemed to follow the line of any survey 7National Land Code (Penang and Malacca Titles)
traverse made by or on behalf of the director of survey before the appointed day for the purpose of determining the line of such foreshore or bank (being a traverse which immediately before the appointed day was still effective for that purpose): provided that--
(a) where no such traverse exists the director shall order that such boundaries be surveyed by right-lines as soon as may be after the appointed day; and
(b) where a revetment, sea wall, river wall or other permanent structure has been lawfully built prior to the appointed day along the line of the foreshore or bank the boundary of the holding shall (unless such boundary shall operate to the disadvantage of the proprietor of such holding) be deemed to follow the line of such permanent structure and such line shall, if this has not already been done on the appointed day, be confirmed by survey as soon as may be thereafter.
() where any permanent works or improvements for the purpose of lawfully diverting water from any river have prior to the appointed day lawfully been constructed by the proprietor of any holding abutting on the bank of any river and such works or improvements were in use on the appointed day, the land upon which such works or improvements were constructed shall be included within the boundaries of such holding.
(3) any person aggrieved by the determination of any boundary under subsection () or () on the ground that the survey traverse referred to therein does not follow the course of any foreshore or bank or that permanent works or improvements have been excluded from the boundaries of a holding may at any time before the title to such holding has become indefeasible pursuant to part vii apply to the director under section 8.
Chapter 3--Preparation and Maintenance of the Interim Register
director to prepare and maintain Interim Register
31. () the director shall prepare and maintain in accordance with and for the purposes of this act a register of all holdings in the state.
8 Laws of Malaysia Act 518
() the Register prepared and maintained under subsection () shall be called the interim Register and shall consist of a series of folios compiled in the serial order of the lot numbers allotted to the holdings included therein.
(3) each folio of the interim Register shall--
(a) relate to a single holding;
(b) be in the form of and contain the particulars prescribed in form d;
(c) be bound in such manner and in a volume containing such number of folios as the director may think fit; and (d) be endorsed with the rent payable for the holding. (4) the director shall affix to each volume of the interim Register a certificate under his hand and seal certifying-- (a) that the volume is part of the interim Register on the appointed day;
(b) the total number of folios in the volume on the appointed day; and
(c) the numbers of the first and last holdings in the volume on the appointed day.
(5) the director may open a folio in the interim Register for any holding or for any surveyed lot upon being satisfied that-- (a) the absence of such a folio for any holding constitutes an omission on the appointed day; or
(b) the surveyed lot corresponds with the unsurveyed portion or with the balance area of a holding which was partly surveyed on the appointed day.
(6) a folio opened in the interim Register pursuant to subsection (5) shall be deemed to be a single holding for the purposes of this act and to have been included therein since the appointed day.
Interim Register to be a public document
32. each volume of the interim Register shall be a public document for the purposes of the evidence act 950 [Act 56]. 9National Land Code (Penang and Malacca Titles)
Where the title to a holding is not clear
33. () whenever the director is not satisfied of the nature, extent or proprietorship of any pre-existing interest in any holding, or in respect of any other matter arising out of or connected with such holding he shall unless he considers that such matter is of a trivial nature or occasioned by a minor error, defect or irregularity, thereupon endorse the appropriate folio of the interim Register with the words "title not clear", and shall sign and date such endorsement and seal it with his seal.
() every endorsement made on any folio of the interim Register under subsection () shall have the same force and effect, and may be withdrawn or released, as if it were a caveat presented by the director in respect of such holding under the national land Code.
correction of errors
34. () at any time before the title to a holding has become indefeasible pursuant to part vii the director may, in relation to any entry in the interim Register relating to such holding, and whether or not he has held an enquiry in respect thereof-- (a) correct any folio of the interim Register which he is satisfied is incorrect, whether due to the inclusion of land included in another folio, or the incorrect description of the parcels or boundaries of the holding comprised therein, or for any other reason;
(b) correct any erroneous entry in the interim Register; or (c) add to the interim Register any matter that has been erroneously omitted therefrom.
() any correction made under subsection () shall be made in such manner as to leave the erroneous matter legible, and shall be authenticated by the director's initials, together with the date on which the correction was made.
(3) where the folio of any holding has been erroneously opened in the interim Register, the director shall cancel such folio by an endorsement of the word "Cancelled" across the said folio and shall sign and date such endorsement and seal it with his seal: 30 Laws of Malaysia Act 518
provided that the cancellation of any folio in relation to a holding which is deemed to be a single title within the meaning of the land acquisition act 960 [Act 486], or any other holding erroneously opened in the interim Register shall not affect the validity of any memorial or entry made therein since the appointed day.
(4) where any holding referred to in the proviso to subsection (3) has been cancelled under the said subsection, the director shall as soon as possible endorse in any folio subsequently opened in the interim Register for the said holding every memorial of registration or entry found in the cancelled folio. (5) a memorial endorsed or entry made in any folio of the interim Register pursuant to subsection (4) shall be deemed to be valid and effective against such holding.
part iv
ReplaCement title
Chapter 1--General
presumption relating to replacement title
35. every replacement title to which any person shall be entitled under this part shall be deemed to arise under this part without any formal alienation or approval thereof.
Chapter 2--Creation of Replacement Title
extinguishment and replacement of existing interests
36. subject to this act, upon the appointed day all pre-existing interests in all lands in the state shall be extinguished and there shall be vested in all persons in whom were vested such corresponding interests in the holdings created in relation to such lands under this act, and the right to such replacement titles to such holdings, as are provided by this Chapter; and unless otherwise provided by this act, every pre-existing deed relating to a holding shall, on and after the appointed day, have effect only as evidence of the nature and extent of any pre-existing interest in such holding:
3National Land Code (Penang and Malacca Titles)
provided that except in so far as any other provision is made by this act nothing in this section shall be construed as preventing any such deed from operating as a contract, or as affecting the rights or liabilities of any person thereunder, either at law or in equity.
general incidents of replacement title
37. upon the appointed day, and thereafter until the title to a holding shall have been declared indefeasible in accordance with part vii--
(a) a replacement title to such holding and all interests therein shall be conclusive only to the extent that the pre-existing interests therein were conclusive according to pre-existing law;
(b) the proprietor of such holding and all other persons entitled to any interest therein shall hold such title or interest subject to the pre-existing law applicable thereto which are not inconsistent with this act;
(c) the proprietor of such holding and all other persons entitled to any interest therein shall in any dealing in respect thereof under part vi be bound by the covenants for title contained in section 7 of the Conveyancing and law of property ordinance [S.S. Cap. 118].
Replacement title protected from adverse possession
38. () on and after the appointed day no title or interest adverse to or in derogation of the replacement title or any replacement interest vested in the proprietor of any holding or in any other person pursuant to this Chapter shall be acquired by any length of possession by virtue of the limitation act 953 [Act 254], or otherwise, nor shall such replacement title or replacement interest be extinguished by the operation of that act.
() nothing in this section shall affect--
(a) the right of any person to make any claim (whether by virtue of adverse possession or otherwise) under section 53, or the due investigation and disposal of such claim; 3 Laws of Malaysia Act 518
(b) the powers of the Court, the board or the director to make any decision or order under this act; or
(c) the exercise of any powers conferred by the national land Code.
Replacement titles
39. the replacement title in respect of any holding to which a person has a right under section 36 shall be--
(a) a grant (first grade);
(b) a grant;
(c) a state lease; or
(d) any of the titles mentioned in the preceding paragraphs with a mukim indication,
as may be appropriate in relation to such holding under this Chapter.
grant (first grade)
40. () where the document of original title to a holding is a grant, indenture or other form of title made or issued by the dutch authorities or by the east india Company or by any Government of the state, and such title created a pre-existing estate in such holding consisting of or in the opinion of the director equivalent to an estate in fee simple, a grant (first grade) shall be issued in respect of such holding.
() (Deleted by Act 55 of 1965).
(3) (Deleted by Act 55 of 1965).
grant
41. where the document of original title to a holding is either a statutory grant issued under the lands ordinance [S.S. Cap. 133] or a lease for nine hundred and ninety-nine years a grant shall be issued in respect of such holding.
33National Land Code (Penang and Malacca Titles)
State lease
42. () where the document of original title to a holding is a lease for a term of less than nine hundred and ninety-nine years and issued under or prior to the coming into force of the lands ordinance a state lease shall be issued in respect of such holding.
() the term of any lease issued under subsection () shall commence on the appointed day and shall be equal to the term unexpired immediately before that day of the pre-existing Crown or state lease of the holding.
Mukim indication
43. () where any holding (or any subdivision of a holding made under section 46) consists of country land not exceeding 4.047 hectares in area, the director, unless he is satisfied that the particular circumstances relating to the holding or to the area in which the holding is situated otherwise require, shall endorse on the relevant folio of the interim Register--
(a) in the case of a grant (first grade), the words "mukim Grant (first Grade)";
(b) in the case of a grant, the words "mukim Grant"; and (c) in the case of a state lease, the words "mukim lease". () the words endorsed under subsection () shall have effect only as an indication that the final documents of title, when issued, will be documents of land office title.
title by adverse possession
44. where any pre-existing interest in a holding has been acquired by adverse possession and the right of action accruing in respect of such possession has been barred by the limitation act 953, then such form of replacement title as is referred to in section 39 shall be issued, or such replacement interest shall be endorsed on the appropriate folio of the interim Register, as the director may consider appropriate to accord due recognition to such interest. 34 Laws of Malaysia Act 518
conditions, etc., of replacement titles
45. () every replacement title shall be subject to the implied condition that--
(a) the land to which the title relates shall be liable to be re-entered by the state if it is abandoned for a period of three years or more; and
(b) after any such re-entry neither the proprietor nor any other person shall have any further right in or claim to the land or any interest therein:
provided that, if within six years after the date of any such re-entry the last proprietor or any other person establishes a claim to the land or an interest therein to the satisfaction of the state director of lands and mines, there may be paid to him such monetary compensation (not exceeding the value of the land or interest as appraised by the state director) as the yang di-pertua negeri may direct.
() every replacement title shall be subject--
(a) to any express covenants, conditions or restrictions appearing in the document of original title which were effective immediately before the appointed day; and (b) in so far as there is no inconsistency with any covenant, condition or restriction of the kind mentioned in paragraph (a), to the appropriate condition (if any) contained in the third schedule.
(3) a covenant, condition or restriction to which a replacement title is subject by virtue of paragraph ()(a) or (b) shall be endorsed on the interim Register in the manner provided by subsections (4), (5) and (6).
(4) where the number and description of an indenture, grant, lease or other instrument are entered in the interim Register under the heading "original tenure", the entry shall be taken as referring to the document of original title and as constituting an endorsement on the Register of such covenants, conditions or restrictions of the kind mentioned in paragraph ()(a) (if any) as appear in the document.
35National Land Code (Penang and Malacca Titles)
(5) where the letter a, b or C is entered in the interim Register under the heading "Replacement title", the entry shall be taken as constituting an endorsement on the Register of the condition contained in the third schedule which is described by the letter so entered.
(6) where the words "first Grade" or "Grant (first Grade)" or any other words indicating that a replacement title is a grant (first grade) are entered in the interim Register, the entry shall be taken as constituting an endorsement on the Register of the condition contained in paragraph 5 of the third schedule. (7) nothing in subsection () shall be deemed to affect sections 89 and 90 of the administration of muslim law enactment 959 [Penang En. No. 3 of 1959], of the state of penang or sections 37 and 38 of the administration of muslim law enactment 99 [Malacca En. No. 5 of 1991], of the state of malacca. Merger and division of titles
46. () subject to this section, where the director is satisfied that--
(a) a document of original title relates to part only of a holding; or
(b) two or more documents of original title relate to different parts of one holding,
he may, instead of issuing the appropriate separate titles under sections 40 to 44 (referred to in this section as separate titles) issue a single replacement title for the holding (referred to in this section as a merged title).
() where the separate titles are of different kinds, then-- (a) if there is a majority title and either--
(i) it is superior to the other separate titles; or (ii) whether or not it is superior to the other separate titles, the proprietor and any mortgagees consent,
the director may issue a merged title in the same form as the majority title;
36 Laws of Malaysia Act 518
(b) in any other case, the director shall not issue a merged title but shall order the subdivision of the holding or make such other arrangements as appear to him to be appropriate in the circumstances.
(3) for the purposes of this section the order of superiority of titles shall be as follows:
(a) first, a grant (first grade);
(b) second, a grant subject to conditions b and C in the third schedule;
(c) third, a grant subject to conditions a and C in the third schedule;
(d) fourth, a grant subject to condition a in the third schedule;
(e) fifth, a grant not subject to a condition in the third schedule;
(f) sixth, a lease subject to conditions b and C in the third schedule;
(g) seventh, a lease subject to conditions a and C in the third schedule;
(h) eighth, a lease subject to conditions a in the third schedule; and
(i) ninth, a lease not subject to a condition in the third schedule.
(4) in this section "majority title" means--
(a) a single separate title to the greater part of a holding; or
(b) two or more separate titles of the same kind which together cover the greater part of a holding.
estates in absolute possession
47. () where a pre-existing estate in absolute possession in any holding is vested--
(a) in any person, such person shall, subject to paragraphs (b) and (c), be registered in the interim Register as the proprietor thereof;
37National Land Code (Penang and Malacca Titles)
(b) in two or more persons as tenants in common, such persons shall be registered in the interim Register as proprietors of undivided shares therein, proportionate to the pre-existing interest of each such person; (c) in two or more persons as joint tenants, such persons shall be registered in the interim Register as co-proprietors thereof, "with a right of survivorship".
() in this section--
"estate in absolute possession" means an estate in possession arising under any pre-existing interest, other than one acquired by adverse possession, and which--
(a) is not the subject of a settlement:
provided that for the purposes of this section an instrument creating a pre-existing joint tenancy in land shall not be deemed to constitute a settlement;
(b) does not arise under a mortgage; and
(c) does not arise by way of lease other than by an assignment for the unexpired term of any pre-existing lease granted by the state,
and includes the estate of a trustee for sale.
(3) paragraphs ()(b) and (c) shall apply, with such modifications as the director may consider necessary, for the purpose of entering in the interim Register the interests of any co-owners of any pre-existing estate other than a pre-existing estate in absolute possession.
Leaseholds
48. () where a pre-existing estate in possession in any holding is vested in a lessee under a lease (other than one referred to in subsection (3)) then subject to Chapter of part v-- (a) the lessor or other person entitled to the reversion therein shall be deemed to hold the replacement title and shall be registered in the interim Register as the proprietor thereof; and
(b) the person in whom the pre-existing estate in possession is vested shall be registered in the interim Register as the lessee under such lease.
38 Laws of Malaysia Act 518
() where a pre-existing estate in possession in any holding is vested in a sublessee then subject to Chapter of part v the person in whom such estate is vested shall be registered in the interim Register as the sublessee thereof.
(3) at any time during the currency of any pre-existing lease or sublease of a holding not exceeding three years and excluded from operation of the Registration of deeds ordinance [S.S. Cap. 121] by section 6 thereof the director may at the request of the lessor, lessee, sublessor or sublessee endorse such lease or sublease upon the replacement title to such holding. (4) a replacement title issued in respect of any holding referred to in subsection () shall be endorsed as subject to a replacement lease or sublease by virtue of the pre-existing lease or sublease.
Mortgages, etc.
49. () where a pre-existing estate in possession in any holding is vested in any person under a mortgage, then subject to Chapter 3 of part v--
(a) the mortgagor or owner of the equity of redemption therein shall be deemed to hold the replacement title and shall be registered in the interim Register as the proprietor thereof;
(b) the person in whom the pre-existing estate in possession was vested shall be registered in the interim Register as the mortgagee under such replacement title.
() a replacement title issued in respect of any holding referred to in subsection () shall be endorsed as subject to a replacement mortgage by virtue of the pre-existing mortgage.
(3) where any interest in any holding, other than a pre-existing estate in possession, is vested in any person under a pre-existing mortgage or charge (including a rent-charge), then subject to Chapter 3 of part v the replacement title to such holding shall be endorsed as subject to a replacement mortgage or charge. 39National Land Code (Penang and Malacca Titles)
(4) this section shall apply to submortgages as it applies to mortgages, subject to the following additional provisions: (a) the existence of the submortgage shall not affect the registration of the mortgagor or owner of the equity of redemption under the original mortgage as proprietor of the holding;
(b) the mortgagee under the submortgage shall be registered as mortgagee; and
(c) the submortgage shall have the same effect as the transfer of a charge under the national land Code.
Settled estates
50. where any holding or any estate or interest therein is a pre-existing settled estate, then subject to Chapter 4 of part v such person as may be entitled to the possession or to the receipt of the rents and profits of such settled estate for a term of years determinable on his death, or for any estate for life, or any person entitled to such possession or receipt as the assignee of any such person shall be registered in the interim Register as the proprietor thereof for life, as trustee.
easements and public rights of way
51. where any holding is subject to a pre-existing easement or public right of way, the replacement title shall be subject to a registered easement or public right of way, to the extent provided by section 7 or 73, as the case may be.
52. (Deleted by Act 55 of 1965). Chapter 3--Claims relating to Replacement Titles
presentation of claims
53. () any person claiming-- (a) that immediately before the appointed day he had any pre-existing interest in any holding in respect of which no corresponding replacement title or interest is entered in the interim Register; or
40 Laws of Malaysia Act 518
(b) that any replacement title or interest entered in the interim Register has been entered wrongly or in error or is or has been extinguished by non-user or otherwise,
may present to the director a claim in respect thereof in form e.
() upon receiving any claim under subsection () the director shall thereupon endorse upon the appropriate folio of the interim Register a notice of such claim, and upon the making of such endorsement every person dealing with such holding shall be deemed to deal with it subject to and with notice of such claim. (3) after making the endorsement required by subsection () the director shall as soon as may be thereafter serve a notice of the claim made under subsection () in form f on all persons to his knowledge affected thereby and take such further action under this act as he may consider necessary for the due investigation and disposal of such claim.
(4) this section shall apply in relation to every holding of customary land in the malacca Customary land Register in respect of which the name of the proprietor has not been determined on the appointed day.
enquiry by director
54. () whenever every person on whom a notice of any claim has been served under subsection 53(3) admits such claim the director shall by writing under his hand and seal amend the interim Register as may be necessary (subject to this act) to give effect to such claim, and shall cancel the endorsement made under subsection 53().
() whenever any person on whom a notice of any claim has been served under subsection 53(3) within one month of the date upon which such notice is served on him objects to or fails to admit such claim, the director shall hold an enquiry and shall give notice to all persons interested therein of the date when and the time and place at which he proposes to hold such enquiry. (3) at any enquiry held under subsection () the director may confirm, amend or reject any claim, as he may think just, and shall so notify all persons interested therein:
4National Land Code (Penang and Malacca Titles)
provided that he shall not cancel any endorsement made under subsection 53() or amend any entry in the interim Register before the period prescribed for appeal shall have expired. Reference to court
55. () whenever any question arises in any claim made under section 53 concerning--
(a) the performance of any of the duties or the exercise of any of the powers imposed or conferred upon the director by this act;
(b) any difficult question of law, or the true construction or validity or effect of any instrument, or concerning the person entitled to any holding or any interest therein, or the extent or nature of the right, interest, power or authority of any person or class of persons; or
(c) any matter in respect of which any entry ought to be made by the director in the interim Register, or the manner in which any doubtful or uncertain right or interest should be dealt with by the director under this act,
and the director considers that such question cannot be disposed of by him in exercise of the powers conferred on him by part ii, he may refer such question to the Court by a reference in form G.
() whenever the director refers any question to the Court under subsection (), he shall serve notice on all parties interested therein accordingly, and shall forthwith enter a caveat upon any appropriate folio or folios of the interim Register. (3) in considering any reference under this section the Court shall allow the director and any of the persons interested in the reference to appear before it, and may summon any other of such parties to appear and show cause either personally or by his advocate and solicitor in relation thereto; and if in such reference the Court, having regard to the parties appearing before it shall think it proper to decide the question contained in such reference it shall have power to do so, or to direct that any proceedings be instituted for that purpose or, at the discretion of the Court and without deciding such question, to direct such entry or entries to be made on the interim Register as under the circumstances shall appear to be just.
4 Laws of Malaysia Act 518
(4) no appeal shall lie from a decision of the Court under this section except with the leave of *the federal Court. (5) the powers conferred upon the director by this section shall be exercisable only by that officer.
(6) any caveat referred to in subsection () shall be entered in accordance with and shall be subject to and removable or renewable under the national land Code.
Part v
effeCt of inteRim ReGistRation
Chapter 1--General
Interpretation
56. in this part, unless the context otherwise requires, a reference to a lease, mortgage, charge or easement means a lease or sublease, a mortgage, submortgage or charge, or an easement, as the case may be, to which this part is applied under part iv. Restrictions to bind proprietor
57. where any pre-existing restriction or limitation in interest relating to any holding is endorsed on any folio of the interim Register, such restriction or limitation shall, subject to this part, bind every proprietor of such holding.
Limitations of replacement title
58. where any person is under this act registered as the proprietor of any holding in the interim Register such person shall be deemed to hold the replacement title thereto under and subject to this act; and such person shall hold such holding free from all pre-existing interests and encumbrances except such as may be entered in the interim Register, but subject to-- (a) any pre-existing easement or public right of way recognised under this act;
*NOTE--previously "the supreme Court"see section 46 of the Constitution (amendment) act 994 [Act A885].
43National Land Code (Penang and Malacca Titles)
(b) the power to correct errors in the interim Register conferred on the director by section 34;
(c) the right of any person in occupation of the holding or any part thereof immediately before the appointed day under any lawful tenancy thereof.
Saving for fraud, contractual rights, etc.
59. nothing in section 58 shall be held to prejudice the rights and remedies of any person--
(a) to have the registered title of a proprietor defeated on the ground of fraud or forgery to which such proprietor or his agent was a party or in which he or his agent colluded;
(b) to enforce against a proprietor any contract to which that proprietor was a party;
(c) to enforce against a proprietor who is a trustee the provisions of a trust;
(d) to recover from a proprietor any holding or any part thereof acquired by him from a person under a legal disability which was known to the proprietor at the time of dealing;
(e) to recover from a proprietor any holding or any part thereof which has been unlawfully acquired by him in purported exercise of any power or authority conferred or created by any written law; or
(f) to enforce any judgment or award of any Court affecting any land made or given before the appointed day,
or arising by virtue of the operation of the limitation act 953, or to confer on a proprietor claiming otherwise than as a purchaser any better title than was held by his immediate predecessor. evidence of entries in Interim Register
60. every copy of a folio of the interim Register duly authenticated under the hand and seal of the director shall be received in evidence in any court, or before any person having by law or by the consent of the parties appearing before him authority to 44 Laws of Malaysia Act 518
admit evidence, as prima facie proof of all the particulars and matters contained in or endorsed on the original folio, and that the person named as proprietor therein or in any memorial or endorsement thereon is or was at the relevant time entitled to the interest specified or described therein in relation to the holding included in such folio.
Chapter 2--Leases
Saving of pre-existing rights, etc.
61. notwithstanding section 36, every replacement lease or sublease endorsed upon the replacement title to any holding in the interim Register under section 48 shall, except as otherwise provided therein or by this act--
(a) be as valid and effectual as was the pre-existing lease or sublease relating to such holding immediately before the appointed day;
(b) continue to be subject to the pre-existing law regulating such lease or sublease and to all the rights and remedies available thereunder;
(c) not affect, or prejudice the enforcement of any estate, right or interest affecting or in derogation of the power to grant the pre-existing lease or sublease of such holding and subsisting or capable of arising immediately before the appointed day.
Chapter 3--Mortgages and Charges
Saving of pre-existing rights, etc.
62. () notwithstanding section 36, every replacement mortgage or charge endorsed upon the replacement title to any holding in interim Register under section 49 shall, except as otherwise provided therein or by section 64 or any other provision of this act--
(a) be as valid and effectual as was the pre-existing mortgage or charge relating to such holding immediately before the appointed day;
45National Land Code (Penang and Malacca Titles)
(b) be deemed to charge such holding as security to the like extent as may be provided by such pre-existing mortgage or charge.
() subject to subsection (), the Conveyancing and law of property ordinance shall continue to apply mutatis mutandis to replacement mortgages and charges registered under this act; and for the purposes of such application, unless the context otherwise requires, where used in such ordinance--
(a) "conveyance" includes a transfer under this act; (b) "mortgage" includes a replacement mortgage or charge; (c) "reconveyance" includes a discharge under this act. (3) to the extent to which any provision of the Conveyancing and law of property ordinance is inconsistent with a provision of this act, the latter shall prevail.
priorities of mortgages
63. subject to this part and to any memorial of postponement in the interim Register, replacement mortgages and charges relating to the same holding shall as between themselves rank according to the order in which the pre-existing mortgages and charges had priority under the Registration of deeds ordinance or the mutations in titles to land ordinance; and subject to this act and of any pre-existing agreement or law the first mortgagee so registered shall have the right to custody of the deeds relating to such holding.
procedure on exercise of power of sale, etc.
64. whenever under any provision of the pre-existing law the right to any remedy would but for this section be exercisable by a mortgagee or any person for the time being entitled to receive and give a discharge for mortgage money under any replacement mortgage or by a chargee under any charge or other right endorsed upon a replacement title under this act, such right shall be exercised in accordance with the fourth schedule, and not otherwise.
46 Laws of Malaysia Act 518
discharge of mortgage or charge
65. upon the repayment or satisfaction of the debt secured by any replacement mortgage or charge of any holding the mortgagee or chargee shall execute a memorandum of discharge in form h and upon the registration of such memorandum such holding shall thereupon be discharged from such mortgage or charge. Chapter 4--Trusts and Settlements
trusts generally excluded from Interim Register
66. the director shall as far as possible exclude from the interim Register references to trusts, whether express, implied or constructive.
pre-existing trusts, etc., to continue
67. whenever any holding is subject to a pre-existing trust or settlement such trust or settlement shall, whether or not it has been registered under the Registration of deeds ordinance or the mutations in titles to land ordinance, remain valid and effectual on or after the appointed day:
provided that where any provision of such trust or settlement has vested or purported to vest in any person any estate in possession, whether in trust or beneficially or for life or a term of years, such provision shall not be deemed to have vested such estate unless it has been duly registered under such ordinance before the appointed day.
Where person entitled to be registered as proprietor is an infant
68. whenever any person entitled to be registered as the proprietor of any holding under this act is on the appointed day under the disability of infancy his parent or guardian shall be registered in the interim Register as the proprietor of such holding as trustee.
47National Land Code (Penang and Malacca Titles)
Registration "as trustee"
69. () the director-- (a) shall, whenever he is satisfied that pursuant to section 50 or 68 any person should be registered as the proprietor of any holding as trustee; and
(b) may, whenever he is satisfied that in any other case it is proper so to do,
enter upon the replacement title of any holding in the interim Register an endorsement that the proprietor thereof holds such land "as trustee":
provided that where the director is satisfied that such proprietor is a trustee for sale he shall not make any such endorsement. () any proprietor registered "as trustee" of any holding under subsection () shall hold such holding in trust for the persons and for the purposes for which it is applicable by law. (3) subject to this act and the national land Code, and of any caveat affecting such title or interest, neither the director nor any person dealing with any replacement title or other interest registered in the interim Register shall by reason of the registration of any person "as trustee" be affected with notice of any trust, express, implied or constructive; and any purchaser thereof shall not be concerned to enquire whether a dealing with the holding comprised therein is within the powers of the proprietor, but shall be entitled to assume that the proprietor has all the powers of disposition of a beneficial owner of the interest in question: provided that in the case of any person registered under section 50 as the proprietor for life as trustee of a holding, such powers of disposition shall not be deemed to exceed those conferred on him by or under any settlement under which such interest arises.
Act not to affect powers under certain laws
70. nothing in this part shall be deemed to affect the exercise of any of the powers conferred upon any person, trustee or Court under the settled estates ordinance and the trustee act 949. 48 Laws of Malaysia Act 518
Chapter 5--Easements and Restrictive Covenants
Registration of easements
71. () where the director is satisfied that a pre-existing easement affecting any holding is of such a kind that, if it were created after the appointed day, it would be an easement within the meaning of the national land Code, he shall make a memorial thereof on--
(a) the folio of the interim Register relating to the holding so affected; and
(b) the folio of the interim Register relating to the holding for the benefit of which the easement exists.
() where a memorial of an easement is made under subsection (), the easement shall have effect as if it were an easement created under the national land Code.
72. (Deleted by Act 55 of 1965). public rights of way
73. () where in the document of original title there is an indication that a holding is crossed by a road or other right of way, the area of which is excluded from the title, the director shall excise the area of the road or, as the case may be, the right of way from the replacement title.
() for the avoidance of doubt it is hereby declared that land excised under subsection () shall become state land.
74. (Deleted by Act 55 of 1965). Part vi
dealinGs on the inteRim ReGisteR
75. (Deleted by Act 55 of 1965). effect of registration
76. () the registration of an instrument of dealing in the interim Register shall have the same effect as regards the indefeasibility of 49National Land Code (Penang and Malacca Titles)
the title or interest thereby transferred or created as the registration of an instrument of dealing under the national land Code. () subsection () shall not affect the operation of section 37; and accordingly, where a replacement title has not yet become indefeasible under part vii, the title or interest protected by that subsection shall be only such title or interest as, having regard to section 37, the transferor or creator was capable of transferring or creating.
pre-executed instruments
77. () except as provided by this section, no unregistered pre-executed instrument shall on or after the appointed day be capable of being registered or of creating, vesting or transferring any interest in a holding.
() where a pre-executed instrument has before the appointed day been provisionally registered under section 6 of the Registration of deeds ordinance, the director shall, notwithstanding subsection 9(3) of that ordinance--
(a) take the instrument into account provisionally in compiling the interim Register, indication that he has done so by a suitable use of the word "provisional"; and
(b) be deemed thereby to have entered a caveat having the same effect as a Registrar's caveat entered under the national land Code.
(3) where an unregistered pre-executed instrument (not being an instrument provisionally registered under section 6 of the Registration of deeds ordinance) is produced to the director within one week after the appointed day and the director is satisfied that the failure to effect its provisional registration under the Registration of deeds ordinance or its registration under the mutations in titles to land ordinance is not due to the negligence or default of the person or body presenting it, then-- (a) if the director is satisfied that all the following conditions are fulfilled:
(i) that the boundaries of the holding to which
the instrument relates have been surveyed and
demarcated in the manner required by the national land Code;
50 Laws of Malaysia Act 518
(ii) that the instrument is properly stamped; and (iii) that all rents, premiums, fees and other sums payable in respect of or in connection with the holding,
and all fees payable in respect of or in connection with the instrument, have been paid,
he shall register the instrument as if it were an instrument of dealing under this act, and the registration shall be deemed to have been effective since the appointed day; and
(b) if the director is not satisfied, he shall enter a caveat in the relevant folio of the interim Register, which shall have the same effect as a Registrar's caveat entered under the national land Code.
(4) where an instrument in respect of which a caveat is deemed to have been or has been entered under subsection () or (3) is presented to the director within six months after the appointed day and the director is satisfied with respect to the instrument that all the conditions specified in paragraph (3)(a) are fullfilled, he shall register the instrument as though it were an instrument of dealing under this act, and the registration shall be deemed to have been effective since the appointed day.
(5) the director may extend the period of six months for the presentation of an instrument under subsection (4) by such further period or periods as he thinks fit if he is satisfied that-- (a) the extension is necessary because of delay (not due to the negligence or default of the person or body presenting the instrument) in assessing or adjudicating stamp duty or in completing survey or the demarcation of boundaries; or
(b) it is otherwise just and equitable to do so.
(6) nothing in the law relating to stamp duties shall be construed as requiring the land administrator to impound any instrument produced or presented to him in pursuance of this section. (7) in this section--
"deed or other instrument" excludes a trust or settlement, but includes a deed or other instrument vesting an estate in possession in accordance with a trust or settlement;
51National Land Code (Penang and Malacca Titles)
"pre-executed instrument" means a deed or other instrument executedbeforetheappointeddayandpurportingtocreate,vest ortransferapre-existinginterest in a holding;
"unregistered" means not registered under the Registration of DeedsOrdinanceortheMutationsinTitlestoLandOrdinance. Instruments to be in prescribed form
78. No deed or other instrument (as defined in section 77) creating, vesting or transferring or purporting to create, vest or transferanyholdingoranyinterestthereinexecutedonorafter theappointeddayandnotbeinginaformprescribedbythisAct ortheNationalLandCodeshallberegisteredunderthisAct,nor shallanysuchdeedorinstrumentbeeffectualtocreate,vestor transferanysuchholdingorinterest.
Saving
79. Nothinginsection77or78shallbeconstruedaspreventing any unregistered instrument from operating as a contract or as affecting the operation of any judgement or award of any Court.
Duties of Director
80. TheDirector-- (a) shallnotregisteranydealinginaholdingunless-- (i) there has been produced to him by the person seeking to effect the dealing the pre-existing
conveyance or other instrument on which that
personreliesasentitlinghimtodosoand,where
therehasbeenapreviousdealingunderthisPart,
thecopyoftherelevantinstrument;or
(ii) whereanysuchconveyanceorinstrumentisnot
produced,heissatisfiedthatthereisareasonable
excuseforitsnon-production;
(b) (Deleted by Act 55 of 1965);
(c) shall not register as proprietor of any holding any personorbodyotherthanapersonorbodyspecifiedin
section43oftheNationalLandCode;
52 Laws of Malaysia Act 518
(d) shallnotbeboundtoregisteranyinstrumentunlessany feesprescribedinrespectthereofhavebeenpaid.
Procedure relating to registration
81. (1) Aninstrumentofdealingrelatingtoaholdingshallnot be effectualuntilithasbeenregisteredby--
(a) presentationtotheDirectorwithacopythereof; and (b) entryofamemorialthereofintheInterim Register, and upon such registration such dealing shall take effect in the mannerprescribedforinstrumentsregisteredinaccordancewith the NationalLandCode.
(2) After registering any dealing under subsection (1) the Directorshall--
(a) returnthecopyoftheinstrumentofdealingpresentedto himtothepersonbywhomitwaspresented;
(b) endorse upon the title deeds produced to him pursuant to paragraph 80(a) the number and description of the instrumentofdealing,togetherwithitsdateofregistration; and
(c) returnsuchtitledeedstothepersonbywhomtheywere presented.
(3) The copy of the instrument of dealing referred to in subsections(1)and(2)shall--
(a) takeeffectasthoughitwereaconveyanceorotherform ofpre-existingtitledeed;
(b) be retained by the person who presented such copy; and
(c) beproducedbysuchpersonasnecessaryinanysubsequent dealing.
(4) Thissectionshallapplyinrelationtoeveryholdingentered inthe InterimRegister:
Provided that when the title thereto has become indefeasible pursuant to Part VII, this section shall apply thereto subject to the deletionof--
(a) the words "with a copy thereof" appearing in
subsection(1);
53National Land Code (Penang and Malacca Titles)
(b) paragraph(2)(a);and
(c) subsection(3).
Dealings prior to indefeasibility
82. (1) (Deleted by Act 55 of 1965). (2) Anypersonpurchasinganyholdingoranyinteresttherein shall,subjecttothisActanduntilthereplacementtitletheretohas become indefeasible pursuant to Part VII, have the same rights relating to the investigation of the pre-existing title thereto as are conferred upon a purchaser by Part II of the Conveyancing and LawofPropertyOrdinance:
Providedthatapurchasershallnotbeentitledtorequireatitle to be deduced for a period of more than thirty years (inclusive ofanyperiodaftertheappointedday)orforaperiodextending further back than a pre-existing grant or lease by the State, whicheverperiodshallbetheshorter.
Dealings after indefeasibility
83. Wheneverthetitletoaholdinghasbecomeindefeasibleunder Part VII, any dealing therein shall be registered in accordance with sections 80 and 81, save that subsection 92(2) shall have effectinplaceofparagraph80(a).
Part VII
INDEFEASIBILITY OFTITLE
Chapter 1--Investigation of Title
Examination of title by the Director
84. (1) At any time on or after the appointed day the Director may,inexerciseofthepowersconferredonhimbythisAct,call for and examine the replacement title to any holding or group of holdings in the Interim Register, and make such enquiries in relationtheretoashemayconsidernecessaryforsuchpurpose. 54 Laws of Malaysia Act 518
(2) Uponbeingsatisfiedofthevalidityofanyreplacementtitle ortitlesreferredtoinsubsection(1)theDirectorshallthereupon publisha noticeinFormI--
(a) describingtheholdingorholdingscomprisedtherein,and theproprietororproprietorsthereof;
(b) statingthatsuchreplacementtitleortitlesappeartobe indefeasibleforthepurposesofthisAct;and
(c) requiringanypersonclaiminganyinterestadversetothe titleoftheregisteredproprietor(andwhetherornotany suit,actionorproceedinghasbeenbroughtinrespectof
anysuchclaim)topresentacaveatinsupportofsuch
claimwithinsixmonthsfromthedateofpublicationof
suchnotice.
(3) NotwithstandinganyprovisionoftheNationalLandCode, anycaveatpresentedunderparagraph(2)(c) maybewithdrawnor releasedbythepersonpresentingit;andifitisnotsowithdrawn orreleasedtheDirectorshallassoonaspossibleholdanenquiry and may thereoneitherconfirmorwithdrawsuchcaveat. (4) When any caveat is confirmed by the Director under subsection(3)thecaveateeorotherpersonclaiminganytitleto or registrable interest in the holding affected thereby may take suchfurtheractionthereonasmaybeprescribedbytheNational Land Code.
Indefeasibility after twelve months' notice
85. Wheneverinrespectofanyholdingspecifiedinanynotice publishedundersubsection84(2)theperiodofsixmonthsfrom thedate ofthepublicationofsuchnoticehasexpired,and-- (a) nocaveathasbeenpresentedthereunder; or
(b) anycaveatpresentedthereunderhasbeenwithdrawnor released,
thenthetitletheretoshallthereuponbecomeindefeasiblewithin themeaningoftheNationalLandCode.
Minors and persons of unsound mind
86. Where any claimant under paragraph 84(2)(c) or any other person who in the opinion of the Director is a necessary party to any enquiry under this Act is or appears to the Director to 55National Land Code (Penang and Malacca Titles)
be a minor or a person of unsound mind, the Director may by an order in writing appoint some suitable and proper person to be the guardian of such minor or person of unsound mind for the purposes of all proceedings under this Act, and all such proceedings shall be as effective and binding upon all persons concerned as if such person had not been a minor or person of unsoundmind.
Examination of title at the instance of a proprietor
87. (1) At any time on or after the appointed day any person registered in the Interim Register as the proprietor of any holding--
(a) shalluponseekingapprovalforanysubdivisionofsuch holding;and
(b) may at any other time with the approval of the Director,
apply for an examination of the replacement title to such holding.
(2) Everyapplicationundersubsection(1)shall--
(a) bemadetotheDirectorinFormJ;
(b) beaccompaniedbyallthepre-existingdeedsrelatingto the holding in the possession or under the control of theapplicant;and
(c) beaccompaniedbyafullabstractoftitletheretoprepared andcertifiedbyanadvocateandsolicitoranddeduced
fortheperiodspecifiedinsubsection82(2):
Providedthatsuchabstractneednotcontaindetails
ofanydealingsrelatingtosuchholdingenteredonthe
InterimRegister.
(3) Upon receiving any application under subsection (1) the Director shall proceed to an examination of title in the manner prescribedbysection84.
(4) (Deleted by Act 55 of 1965).
Indefeasibility after twelve years on Interim Register
88. (1) Whenontheexpirationoftheperiodoftwelveyearsnext following the appointed day, which period the State Authority may,bynotificationintheGazette,fromtimetotimeextendby 56 Laws of Malaysia Act 518
suchfurtherperiodastheStateAuthoritymayconsidernecessary, thetitletoanyholdinghasnotbeendulyexaminedpursuantto this Chapter, such title shall, on and from such date, become indefeasiblewithinthemeaningoftheNationalLandCode: Providedthatwhenatsuchtimeanycaveatorclaimpresented or made under this Act is then outstanding, no such title shall becomeindefeasibleuntilsuchcaveatorclaimhasbeendisposed oforwithdrawn.
(2) Whentheproprietorofanyholdingreferredtoinsubsection (1)firstdealstherewithonoraftertheexpirationoftheperiodof twelveyearsnextfollowingtheappointedday,heshallthereupon surrender to the Director all the documents of title and other instruments relating to such holding and in his possession or underhis control.
Chapter 2--Certificates of Title
Certificate of indefeasibility
89. WhenevertheDirectorissatisfiedthatthetitletoanyholding intheInterimRegisterhasbecomeindefeasiblepursuanttothis Part,heshallthereupon--
(a) makesuchadditionstooramendmentsintheendorsements upontheappropriatefoliooftheInterimRegisterashe
mayconsidernecessary;and
(b) place upon the Interim Register a memorial under his handandsealthatsuchtitleis,onandfromsuchdateas
maybespecifiedinsuchmemorial,indefeasiblewithin
themeaningoftheNationalLandCode.
Cancellation of pre-existing deeds
90. (1) WheneveracertificatehasbeenplacedupontheInterim Register pursuant to paragraph 89(b) the Director shall in the exerciseofthepowersconferredonhimbysection9obtainall the pre-existingdeedsrelatingtosuchholding,unless theseare alreadyinhispossession.
(2) Wherethepre-existingdeedsrelatingtoanyholdinginthe possession oftheDirectorrelate--
(a) only to the land comprised within such holding, the Directorshallcanceleachsuchdeedbyanendorsement
made thereon under his hand and seal, indicating the dateofsuchcancellation,andshallthenimpoundsuch
deed;
57National Land Code (Penang and Malacca Titles)
(b) alsotoanylandnotcomprisedwithinsuchholding,the Director shall endorse upon each such deed the note "Cancelled with respect to Holding. . . . ." under his handandseal,indicatingthedateofsuchendorsement,
andshallreturnsuchdeedtothepersonentitledtothe
custodythereof:
Provided that a document of original title containing any expresscovenants,conditionsorrestrictionswhichwereinforce immediatelybeforetheappointeddayshallnotbedealtwithas providedbyparagraphs(a) and(b) untilaftertheissueof final documentsoftitle.
(3) Whereanyholdingreferredtoinsubsections(1)and(2)is subjecttoareplacementmortgage,charge,leaseorsublease-- (a) thepre-existingdeedsrelatingtosuchmortgage,charge, leaseorsubleaseshallnotbecancelledundersubsection (2)andshallbedeemedforthepurposeofthisActand
the National Land Code to continue to have effect as instrumentsofdealing;
(b) (Deleted by Act 55 of 1965).
(4) Uponmakinganyendorsementuponanydeedrelatingto any holding pursuant to subsection (2) the Director shall enter upon the appropriate folio of the Interim Register a memorial that the pre-existing deeds relating to such holding have been cancelledunderthissection.
Release of documents of historic interest
91. WheretheDirectorissatisfiedthatanydocumentorinstrument impounded under paragraph 90(2)(a) is of historical interest or foranyotherreasonshouldnotbeimpounded,hemayuponthe applicationinFormKbytheproprietorof,oranyotherperson having any interest in, the holding to which such document or instrument relates deliver any such document or instrument to the applicant, and in such event shall retain such application as the authorityforsuchdelivery.
58 Laws of Malaysia Act 518
Advance certificate of title
92. (1) TheDirectorshall,uponthecompletionoftheprocedure prescribed inrelationtoanyholdingbysection90--
(a) prepare and issue to the proprietor or chargee or other person entitled to the custody thereof an advance certificate of title in Form L endorsed with particulars of any charges, leases or other interests to which such holdingissubject;and
(b) causefinaldocumentsoftitletobepreparedinaccordance withsection93.
(2) Anypersonwho,aftertheissueofanadvancecertificateof titleandbeforetheissueofthefinaldocumentoftitlerelatingto anyholding,dealsinsuchholding,shallpresentsuchcertificate of title to the Registrar, together with a memorandum of such dealing; andtheRegistrarshall--
(a) entersuchdealingbywayofmemorialunderhishand
andsealintheInterimRegister;
(b) underhishandandsealendorsesuchmemorialuponthe advancecertificateoftitle;and
(c) returnsuchcertificatetothepersonentitledthereto. (3) Notwithstanding subsection (1) the Director may, on and aftertheexpirationoftheperiodoftwelveyearsnextfollowing the appointed day, in his discretion proceed to issue a final documentoftitletoanyholdingwithoutfirstissuinganadvance certificateoftitleinrespectthereof.
Final documents of title
93. (1) Subject to this section, final documents of title shall be prepared, issued and subsequently treated as if they were documentsoftitlepreparedandissuedundertheNationalLand Codeon alienationunderfinaltitle.
(2) In thepreparationandissueoffinaldocumentsoftitle-- (a) the functions of the Registrar (but not of the Land Administrator) under the National Land Code shall be exercisedbytheDirector;and
59National Land Code (Penang and Malacca Titles)
(b) the Land Administrator shall exercise his functions undertheNationalLandCodeinaccordancewithsuch
instructionsashemayreceivefromtheDirector.
(3) TheDirector--
(a) shallenterorcausetobeenteredinthefinaldocument oftitlerelatingtoaholding--
(i) thenameoftheproprietoroftheholdingasentered
intheInterimRegister;and
(ii) detailsofallleases,chargesandotherintereststo whichtheholdingissubject;and
(b) wheretheholdingissubjecttoaconditionofthekind mentioned in subsection 45(2), shall endorse or cause tobeendorsedonthedocument--
(i) inthecaseoftheconditionsetoutinparagraph5
oftheThirdSchedule,thewords"FirstGrade";
and
(ii) inanyothercase,thewordsoftheconditionas
they appear in the document of original title or
theThirdSchedule, asthecase maybe.
(4) The final document of title for a holding shall be issued intheformwhichcorrespondstothereplacementtitleenteredin the InterimRegister;andforthepurposesof thissubsection-- (a) agrantundertheNationalLandCodecorrespondstoa
grant(firstgrade)withoutaMukimindicationoragrant
withoutaMukimindication;
(b) aStateleaseundertheNationalLandCodecorresponds toaStateleasewithoutaMukim indication;
(c) aMukimgrantundertheNationalLandCodecorresponds to a grant (first grade) with a Mukim indication or a grantwithaMukimindication;and
(d) aMukimleaseundertheNationalLandCodecorresponds toaStateleasewitha Mukimindication.
60 Laws of Malaysia Act 518
(5) When the final document of title has been prepared for a holding, theDirectorshall--
(a) callforanddestroytheadvancecertificateoftitle;and (b) endorseontheappropriatefoliooftheInterimRegister a signedanddatedcertificateto theeffectthat--
(i) theadvancecertificateoftitlehasbeendestroyed; and
(ii) thetitlehasbeencontinuedinthefinaldocument
oftitle(whichshallbespecified).
(6) Noissuedocumentoftitleshallbeissueduntilsubsection (5) hasbeencompliedwith.
Part VIII
PROVISIONSRELATINGTOMALACCA
Chapter 1--Preliminary
Interpretation
94. (1) In thisPart,unlessthecontextotherwiserequires-- "certificated land" means any customary land subject to Chapter 3ofthisPart;
"certificated person" means any person to whom a certificate has been issued under section 104, or who, not being a Malay, isdeemed tobeaproprietorunderparagraph99(c);
"customary land" means land which, immediately before the appointed day, was customary land within the meaning of the Ordinance and includes land in respect of which the title had beenendorsedundersubsection109a(2)andlandre-alienatedor otherwise disposedofundersubsection109b(3);
"customary landholder" means a person who, immediately beforetheappointedday,wasregisteredundertheOrdinanceas theholder ofcustomaryland;
61National Land Code (Penang and Malacca Titles)
"MalaccaCustomaryLandRegister"hasthemeaningassigned bysection102;
"Malacca Customary Land company" means a company incorporated pursuant to any written law for the time being in force inrelationtocompanies--
(a) allmembersofwhichareMalays;
(b) thearticlesofassociationofwhichprohibitthetransfer ofitssharestoanypersonwhoisnota Malay;and
(c) one of the objects of which is to deal in customary land;
and a Malacca Customary Land company, as so defined, shall, forthepurposeofthisPart,bedeemedtobeaMalay;
"Malay"meansapersonwhoprofessesthereligionofIslam, habitually speaks Malay language, conforms to Malay custom and--
(a) wasbeforeMerdekaDaybornintheFederationorborn
ofparentsoneofwhomwasbornintheFederation,or
wasonthatdaydomiciledintheFederation;or
(b) istheissueofsuchaperson;
"Ordinance" means the Malacca Lands Customary Rights Ordinance of the Straits Settlements as in force in the State of Malaccaimmediatelybeforetheappointedday,andrepealedby section96;
"StateAuthority"meanstheYangdi-PertuaNegerioftheState whoshallactinaccordancewiththeadviceoftheStateExecutive Council or a member thereof acting under the general authority oftheCouncil.
(2) (Deleted by Act A731).
Application
95. ThisPartshallapplyonlytotheStateofMalacca. 62 Laws of Malaysia Act 518
Repeal
96. The Malacca Lands Customary Rights Ordinance is repealed.
Special provision relating to the Naning Custom
97. WhenevertheLandAdministratorissatisfiedthatanyland intheMalaccaCustomaryLandRegisterissubjecttotheNaning custom, he shall endorse the appropriate folio of the Register withthewords,"Naningcustom".
Finality of certain boundaries
98. Wheretheboundaryofanyholdinghasbeenorisdeemedto havebeenfinallyascertainedorconfirmedundertheOrdinance, or where the proprietor or mortgagee of any such holding or anyofhispredecessorsintitlehas,byanyconveyanceorother instrumentorinanyenquiryunderthisActdealtwithoraccepted theboundariesofsuchholdingassurveyedundertheOrdinance, suchboundaryshallbedeemedforthepurposesofthisActtobe final and conclusive and shall not be called in question in any proceedingsunderthisAct.
Chapter 2--Application of the National Land Code
Effect of repealing the Ordinance
99. (1) On and after the appointed day customary landholders shallcontinuetobedeemedtohaveapermanentandtransferable rightof occupancyintheircustomaryland,butotherwise-- (a) shallceasetoholdtheircustomarylandsubjecttoand inaccordancewiththeOrdinance;and
(b) shallholdtheircustomarylandsubjecttoandinaccordance withthisPartandtheNationalLandCode.
(2) IntheapplicationoftheNationalLandCodetocustomary land--
(a) thelandshallbedeemedtobelandalienatedbeforethe commencementoftheCode;
63National Land Code (Penang and Malacca Titles)
(b) thelandholdershallbedeemedtobeaproprietorwithin themeaningoftheCode;and
(c) theMalaccaCustomaryLandRegistershallbedeemedto beaMukimRegister withinthe meaningoftheCode:
ProvidedthatthisPartshallprevailovertheCodeintheevent ofinconsistency:
ProvidedfurtherthatnotitleintheMalaccaCustomaryLand RegistershallbecomeindefeasibleinaccordancewiththeNational Land Code unless the name of the proprietor or the names of allproprietorshasorhavebeenenteredthereinontheappointed dayorpursuanttoaclaimmadeundersection53orpursuantto any orderoftheBoardorofthe Court.
Saving relating to incomplete proceedings
100. Whereanyactorproceedinghas,beforetheappointedday, beenlawfullycommencedbutnotcompletedundertheOrdinance it may be continued and completed under any corresponding provisionoftheNationalLandCode:
ProvidedthatwhereanyforminScheduleAoftheOrdinance has been duly executed but not presented or, if presented, has not been duly registered before the appointed day, then such presentationorregistrationorbothmaybemadeaftertheappointed dayandsuchformshallbedeemedtobeaprescribedformfor the purposesofthisAct.
Rent
101. The assessment payable in respect of any customary land undersections32to36oftheOrdinanceimmediatelybeforethe appointeddayshall,subjecttosubsection(2),continueinforce thereafterandshallbedeemedtobetherentduethereonunder the National Land Code, and shall be payable and recoverable in accordancewithsuchCode.
(2) The StateAuthority may, within a period of three years beginningwiththeappointedday,alteranyassessmentreferredto insubsection(1)inaccordancewithsection33oftheOrdinance (notwithstandingitsrepeal),andsuchassessmentshallthereupon bedeemedforthepurposesoftheNationalLandCodetobethe 64 Laws of Malaysia Act 518
rentfixedonthelandonwhichanysuchassessmentisimposed, andshallnotthereafterberevisedexceptunderandinaccordance withsuchCode.
Malacca Customary Land Register
102. Subjecttothissection,theMukimRegisterkeptunderthe Ordinance shall continue in existence after the appointed day, butshallbeknownastheMalaccaCustomaryLandRegister. (2) Asandwhenitisexpedienttodoso,theLandAdministrator shall prepare and issue documents of title under the National Land Code in continuation of the titles entered in the Malacca CustomaryLandRegisterand,indoingso,shallfollowasnearly as may be the procedure prescribed by the National Land Code in respect of land held on a Mukim grant for the issue of final title incontinuationoffinaltitletolandasawhole:
Providedthat--
(a) sections166to169oftheCodeshall notapply; and
(b) nofeeshallbechargeable.
(3) The Land Administrator shall register an instrument of dealingwithrespecttoaholdingofcustomaryland--
(a) wheretitleincontinuationhasnotyetbeenissuedunder subsection(2),byenteringamemorialofthedealing(the memorialbeingsignedanddatedandotherwiseinsuch
termsastheLandAdministratorconsidersappropriate)
intheMalaccaCustomaryLandRegisterandfilingthe
instrument;and
(b) where title in continuation has been so issued, in the mannerprovidedbytheNationalLandCode.
(4) Registrationunderparagraph(3)(a) shallbedeemedtobe, andshallbeaseffectiveas,registrationundertheNationalLand Code.
(5) TheMalaccaCustomaryLandRegistershallbemaintained separately fromallotherregistersrelatingtolandinthe State. 65National Land Code (Penang and Malacca Titles)
Mortgages of customary land
103. Upon the appointed day every pre-existing charge by way of legal mortgage of any customary land duly registered under the Ordinance shall be deemed to be a charge duly registered undertheNationalLandCode:
Providedthat--
(a) subjecttoparagraph(b),everysuchchargeshallcontinue to be subject to all the express and implied conditions thereof subsisting immediately before the appointed day;
(b) notwithstandinganyexpressorimpliedconditionreferred toinparagraph(a),theNationalLandCodeshallapply
to the discharge of any such charge and in relation to anyremediesofthechargeethereunder;
(c) notwithstandingtheNationalLandCode,itshallbean impliedconditionofanychargedeemedtoberegistered
underthissectionthatnochargeeorotherpersonshall
haveanyrighttoenterintopossessionthereunderifhe
isnotcompetenttoholdsuchland underthisPart.
Chapter 3--Certificated Lands
State Authority may declare a person to be a certificated person
104. (1) Whenever the State Authority is satisfied that any personwhoisnotaMalayisentitledtoorotherwiseshouldbe registeredastheproprietorofanycustomaryland(otherwisethan bywayofsuccessionpursuanttoparagraph105(b) hemayissue acertificatetosuchperson,specifyingthenameofsuchperson andthelandinrespectofwhichsuchcertificateisissued. (2) Whenever any certificated person presents to the Land Administrator any certificate referred to in subsection (1) the LandAdministrator shall record such person in the appropriate foliooftheMalaccaCustomaryLandRegisterastheproprietor ofthelandspecifiedtherein,andshallendorsesuchfoliointhe mannerprescribedbyparagraph105(c).
66 Laws of Malaysia Act 518
Certificated land
105. Whereanycertificatedpersonisregisteredastheproprietor ofanycustomaryland--
(a) he shall not by reason of his status as a certificated person be deemed to be entitled to be registered as theproprietorofanycustomarylandotherthanthatto
whichhemaybeentitledunderparagraph99(c) orany
certificateissuedtohimundersection104;
(b) he shall have a permanent and hereditable right to the ownershipofsuchland,anduponhisdeceasesuchland
shallbetransmissibleaccordingtothelawforthetime
beinginforcerelatingtosuccession;
(c) the title to such land in the Malacca Customary Land Registershallbeendorsedwiththewords"Certificated
Land".
When land ceases to be certificated land
106. Whenever any certificated land at any time, whether by transfer,successionorotherwisebecomesregisteredinthename ofanyMalay,theDirectorshallthereuponcanceltheendorsement referred to in paragraph 105(c), and such land shall thereupon cease to becertificatedland.
Chapter 4--Restrictions in Use and Interest
107. (Deleted by Act 55 of 1965). Limitation
108. (1) Subject to Chapter 3, the following provisions shall applytolandsubjecttothisPart:
(a) no such land may at any time be transferred, leased, transmittedorchargedtoanypersonotherthanaMalay.
Forthispurpose"lease"doesnotincludeatenancyfor
a term not exceeding three years or a lease for a term exceedingthreeyearsbutnotexceedingthirtyyears;
67National Land Code (Penang and Malacca Titles)
(aa) notenancyorleasegrantedinrespectofanysuchland to any person other than a Malay may at any time be transferred to any person other than a Malay; and no subtenancy or sublease of whatever form or duration shall be granted to any person in respect of any such land from any tenancy or lease granted to any person otherthanaMalay;
(b) nolienbydepositoftheissuedocumentoftitleforany suchlandassecurityforadebtshallbecapableofbeing
createdinfavourofanypersonotherthanaMalay,and
no caveat in support of such lien by deposit shall be capableofregistrationundertheNationalLandCode;
(c) no caveat, not being a caveat as is referred to in paragraph(b) oraRegistrar'scaveatundertheNational LandCode,againstthetitleforanysuchlandshallbe
capableofregistrationundertheNationalLandCodein
any case where the caveator is not a Malay, or in any casewherethecaveatorisactingasagent,hisprincipal
isnotaMalay;
(d) everytrustorallegedtrust,whethersuchtrustbeexpress, implied or constructive, which purports to be created inrespectofanysuchlandbytheproprietorinfavour
oforforthebenefitofanypersonwhoisnotaMalay
shall be null and void and shall be incapable of being enforcedbyanyCourt;
(e) nograntofprobateorlettersofadministrationshalloperate to vest any such land in any executor or administrator whoisnotaMalay;
(f) nopowerofattorneyoranyformofagencyinrespectof thelandshallbecapableofbeinggrantedto,orcreated
infavourofanypersonwhoisnotaMalay.
(2) Notwithstandingparagraph(1)(a),landsubjecttothisPart may be charged to any person or body specified in the Sixth Schedule or transferred to any person or body specified in the SeventhSchedule.
(3) For the purposes of paragraph (1)(e) the *Public Trustee orOfficialAdministratorshallbedeemedtobeaMalay.
*NOTE--All references to "Public Trustee or OfficialAdministrator" shall be construed as "Corporation" see section2andsubsection43(3)ofthePublicTrustCorporationAct1995[Act 532]. 68 Laws of Malaysia Act 518
(4) Any transfer, lease, transmission or charge contrary to paragraph(1)(a) shallnotbevalidforthepurposeofregistration underthisPartandshallnotbecapableofregistrationunderthe NationalLandCode.
(5) Noactionforbreachofcontractshalllieinrespectofany dealing in or disposal of or any attempt to deal in or dispose of any land subject to this Part contrary to subsection (1) and no rent paid in pursuance of such dealing or attempt shall be recoverableinanyCourt.
(6) The State Authority may from time to time, by order publishedintheGazette,addto,deletefromoramendtheSixth ScheduleortheSeventhSchedule.
Liability of land to forfeiture where a Malacca Customary Land company ceases to be such
108A. Ifatanytimewhilstacustomarylandisownedby,charged or leased to, or is otherwise held in the name of, a Malacca CustomaryLandcompanypursuanttoparagraph108(1)(a),such company ceases to be a Malacca Customary Land company as definedinsubsection94(1)--
(a) the land shall become liable to forfeiture to the State Authority;and
(b) exceptinacasewhereactionforthepurposeofrestoring thecompanyasaMalaccaCustomaryLandcompanyis
firstrequiredtobetakenundersection108b,theLand
Administratorshallproceedwiththeenforcementofthe
forfeitureinaccordancewithsection108c.
Summary action to secure restoration of the status of a Malacca Customary Land company
108b. (1) Where--
(a) any customary land is liable under section 108a to forfeituretotheStateAuthority; and
(b) itappearstotheLandAdministratorthatactioniscapable ofbeingtakenbytheMalaccaCustomaryLandcompany
inquestionwithinareasonabletimetorestoreitselfas
a MalaccaCustomaryLandcompany,
69National Land Code (Penang and Malacca Titles)
theLandAdministratorshallserve,orcausetobeserved,onthe companyanoticeinForm"M"intheFirstSchedulespecifying theactionrequiredtobetakeninthisregardandcallinguponit to takesuchactionwithinthetimethereinspecified.
(2) Upon the service of any notice under subsection (1), the Land Administrator shall endorse, or cause to be endorsed, on the register document of title to the land in question a note to theeffectthatactionisbeingtakenunderthissectioninrespect oftheland.
(3) If the notice under subsection (1) is complied with, the note endorsed under subsection (2) shall be cancelled and the landshallnotbeforfeitedunder section108a.
(4) Ifthenoticeundersubsection(1)isnotcompliedwith,the LandAdministratorshalltakeactioninaccordancewithsection 108c.
Action to enforce forfeiture
108c. (1) Subjecttosection108b,theLandAdministratorshall take action under this section whenever any customary land is liabletoforfeitureundersection108a.
(2) TheLandAdministratorshall--
(a) causeanoticeinForm"N"intheFirstScheduletobe
servedonthecompany;and
(b) cause a copy of that notice to which there shall be appendedtheadditionalnoticesetoutinthesupplement
tothattobeservedon--
(i) any person or body having a registered interest affecting the land (including a charge of any
leaseorsubleasethereof);
(ii) anypersonorbodyhavingalienoverthelandor
overanyleaseorsubleasethereof;
(iii) any person or body in occupation of any part thereofunderanytenancyexemptfromregistration;
and
70 Laws of Malaysia Act 518
(iv) any person or body having a claim protected by caveat affecting the land or any interest
therein.
(3) Upon the service of a notice under subsection (2), the Land Administrator shall endorse, or cause to be endorsed, on the register document of title to the land in question a note to theeffectthatactionisbeingtakenunderthissectioninrespect oftheland.
(4) Uponthedate,andatthetimeandplace,specifiedinsuch notice,theLandAdministratorshallholdanenquiryandonthe conclusion thereof--
(a) ifitappearstohimthatthecompanyhasrestoreditselfas aMalaccaCustomaryLandcompany,heshallsodeclare
byorder,andshallcancelorcausetobecancelledany
noteendorsedunderthissection orsection108b;
(b) if it appears to him just that further time should be allowedforenablingthecompanytorestoreitselfasa
Malacca Customary Land company, he shall make an
orderspecifyingtheactiontobetakenforthatpurpose,
andthetimewithinwhichitisto betaken;or
(c) inanyothercase,heshallmakeanorderdeclaringthe landforfeittotheStateAuthority.
(5) If the order under paragraph (4)(b) is complied with, the Land Administrator shall cancel or cause to be cancelled any noteendorsedunderthissectionorsection108b.
(6) Ifthesaidorderisnotcompliedwith,theLandAdministrator shall,ontheexpiryoftheperiodspecifiedtherein,makeafurther orderdeclaringthelandforfeittotheStateAuthority.
Forfeiture to take effect upon notification in the Gazette 108d. (1) Assoonasmaybeafterthemakingofanorderunder section108cwithrespecttoanyland,theLandAdministratorshall publish in the Gazette a notification of forfeiture in Form "O" in the First Schedule, and upon such publication, the forfeiture shalltakeeffectasmentionedinsection109b.
71National Land Code (Penang and Malacca Titles)
(2) Copiesofanynotificationpublishedundersubsection(1) shall--
(a) beaffixedinaconspicuousposition--
(i) onthelandandinthePenghulu'sofficeorbalai
intheareainwhichthelandissituated;and
(ii) in that area, on such court-houses and mosques (if any) and in such markets and other public
places(ifany)astheLandAdministratorthinks
fit;and
(b) wheretheStateAuthorityconsidersthatpublicationina newspaperisdesirable,bepublishedinsuchnewspaper
circulatingintheStateastheLandAdministratorthinks fit, and the LandAdministrator shall, as soon as may be after the notification is published, register or cause to be registered a memorial thereof upon the register documentoftitletothelandinquestion.
Right of re-entry
109. (1) All land subject to this Part shall be deemed to be subject to a right of re-entry on behalf of the State Authority upon any breach of or default in the observance of this Part or of any conditions created or implied thereunder; and such right shallbeexercisedinaccordancewithandshallbesubjecttothe NationalLandCode,asifsuchbreachordefaultrelatedtoany conditionimpliedorimposedthereunder.
(2) Where a right of re-entry is exercised on behalf of the StateAuthorityunderthissectioninrespectofanylandsubject to this Part, an endorsement of the re-entry shall be made in theMalaccaCustomaryLandRegister,andinthecaseofatitle endorsed under subsection 109a(2), in the respective register, againstsuchland.
(3) (Deleted by Act A649).
(4) (Deleted by Act A649).
72 Laws of Malaysia Act 518
Application for endorsement of title as Malacca Customary Land
109A. (1) Any proprietor of any alienated land who is a Malay may,withtheconsentofeverypersonhavingarightorinterest thereinapplytotheStateAuthoritytohavethetitletotheland endorsedasaMalaccaCustomaryLand.
(2) UponapprovalbytheStateAuthorityundersubsection(1), theRegistrarortheLandAdministratorshallendorseorcauseto be endorsed a note thereof on the register and issue documents oftitletothelandtowhichitrelates.
(3) Uponendorsementthereofontheregisterandissuedocuments oftitle,thelandshallbesubjecttothis Part.
Effect of re-entry
109b. (1) Where re-entry on any land subject to this Part is effected under section 109, forfeiture shall be deemed to have takeneffectinrespectofthatlandand--
(a) thelandshallrevertto,andvestin,theStateAuthority freedanddischargedfromalltitlesandinterestssubsisting or capable of arising immediately before the forfeiture tookeffect;and
(b) thereshallalsovestintheStateAuthority,withoutpayment of compensation and subject to any provision to the contraryinthedocumentoftitletothelandinquestion,
or,asthecasemaybe,thelease,thelicenceorpermit
in question, all buildings on the land (by whomsoever erected) other than any of temporary construction and capableofremoval.
(2) Thelandshallnotbere-alienatedorotherwisedisposedof toanypersonwhoisnotaMalayortoastatutoryauthority,body orcorporationwhichisnotspecifiedintheSeventhSchedule. (3) Whereanysuchlandisre-alienatedorotherwisedisposed of to a Malay or to a statutory authority, body or corporation specified in the Seventh Schedule, it shall be deemed to be customaryland.
(4) The land so re-alienated shall be held in perpetuity and the title shall be registered in the Malacca Customary Land Register.
73National Land Code (Penang and Malacca Titles)
Effect of surrender
109c. WheneveranycustomarylandissurrenderedtotheState AuthoritypursuanttotheNationalLandCode,thelandshallrevert toandvestintheStateAuthorityasStateland,andsection109b shallapplyasifthelandhadrevertedpursuant toaforfeiture. Part IX
NATURALRIGHTS
110. (Deleted by Act 55 of 1965).
111. (Deleted by Act 55 of 1965). Special rights of certain riparian proprietors
112. The proprietor of any holding which under section 30 is deemed to follow the line of a survey traverse, whether made before,onoraftertheappointedday,orthelineofanypermanent structure, may on and after the appointed day as of right and withoutpaymentofanyfeetherefordivertwaterfromanyriver onwhichsuchholdingabutstothelikeextenttowhichhemay lawfully have made any such diversion prior to the appointed day:
Provided that the power conferred by this section may be exercisedonlytotheextentthattherightsofotherlawfulusers ofwaterfromsuchriverarenot therebyaffected.
Part X
GENEraL
Offences and penalties
113. (1) Anypersonwho-- (a) fraudulentlyprocures,assistsinfraudulentlyprocuring,or isprivytothefraudulentprocuringofanydocumentof
titleorotherinstrument,orofanyentryintheInterim
74 Laws of Malaysia Act 518
Register, or any alteration or erasure of or addition to anyentryintheInterimRegister,orinanyinstrument
orformissuedbytheDirector;
(b) afterarequisitioninwritingmadebyanyofficerpursuant toparagraph9(1)(b),withoutreasonableexcuserefuses orneglects--
(i) toproduceanydeedordocumentinhispossession
or under his control or to allow such deed or
documenttobeinspectedbysuchoffice;or
(ii) togiveinformationastothewhereaboutsofany
deedordocumentorthepersoninwhosecustody
anydeedordocumentmaybe;
(c) fraudulently uses or assists in fraudulently using or is privytothefraudulentusingofanyinstrumentorform
purportingtobeissuedorauthorizedunderthisAct;
(d) knowinglymisleadsordeceivesorfailstocomplywith anylawfulrequestofanypersonauthorizedbythisAct
toobtaininformationinrespectofanylandorholding;
or
(e) fraudulentlyremovesfromtheInterimRegisteranypart thereof,orcausesanydefacement,obliteration,mutilation orunauthorizedentryoralterationtobemadethereto;
(f) (Omitted)
shall be guilty of an offence and shall, on conviction, be liable to a fine not exceeding two thousand ringgit or to a term of imprisonmentnotexceedingthreeyearsortoboth.
(2) Noproceedingorconvictionforanyactpunishableunder subsection(1)shallaffectanyremedywhichanypersonaggrieved orinjuredbysuchactmaybeentitledtoagainstthepersonwho committedsuchactorhisestate.
Rules
114. (1) The Minister may, after consultation with the Yang di-PertuaNegeri,makerulesforcarryingoutorgivingeffectto 75National Land Code (Penang and Malacca Titles)
thepurposesofthisActand,withoutprejudicetothegenerality ofsuchpower,maybysuchrules providefor--
(a) thepowersanddutiesofofficersappointedorexercising anypowersconferredbyorunderthisAct;
(b) thepracticeofanyofficeordepartmentoftheGovernment of the Federation or the State in relation to matters arisingunderthisAct;
(c) theprocedureandpracticeoftheBoard;
(d) theformsofinstrumenttobeusedunderthisAct;
(e) theamendmentoftheFirstSchedule;
(f) subject to section 117, the fees, if any, to be charged for any matter or thing to be done under thisAct, the methodbywhichsuchfeesshallbeaccountedforand
disposed of, and the circumstances in which such fees maybedispensedwithorremitted;
(g) prescribing anything required by this Act to be prescribed;
(h) the procedure and practice relating to the presentation andregistrationofinstrumentsunderthisAct;
(i) the issue in cases of loss or destruction of duplicate certificates and other documents used for the purposes ofthisAct;
(j) thedisposalofanyregisters,titlesandotherdocuments the validity or operation of which has pursuant to this Actceasedorbecomeextinguished.
(2)Allrulesmadeunderthissectionshallbepublishedinthe Gazette oftheState.
Service of notices, etc.
115. Anynotice,summonsorotherprocesstobeservedunder thisActmaybeservedinthemannerprescribedfortheservice of notices, summonses and other processes under the National Land Code.
76 Laws of Malaysia Act 518
Saving of rights of Land Administrator, etc.
116. Nothing in this Act shall affect the right of the Land Administratororofanyotherpersonorauthorityempoweredby any written law to enter on any land subject to thisAct under anypowerorauthorityconferredbysuchwrittenlaw.
Surveys to be free of charge
117. Nofeeshallbechargedinrespectofanysurveyundertaken byoronbehalfoftheDirectorofSurveyforthepurposeofthis Act (not being a survey consequential upon the exercise by a proprietorinrespectofhisholdingofapowerconferredbythe NationalLandCode).
Repeal
118. (1) TheOrdinancessetoutintheFifthSchedulearerepealed to the extentthereinspecified:
Providedthat--
(a) suchOrdinancesshallremaininforceforthepurposeof determining the nature and extent of any pre-existing interests;
(b) suchOrdinancesshallberepealedwithoutprejudiceto the validity of any boundaries finally ascertained and confirmedorconfirmedthereunder,orofanymapsorplans preparedorvalidatedundertheauthority thereof;
(c) excepttosuchextentastheymaybeinconsistentwith thisAct, the repealed provisions of the Conveyancing and Law of Property Ordinance shall not be repealed inrelationtoanydealinginanyholdinguntilthetitle
theretohasbecomeindefeasiblepursuanttothisAct.
(2) (Deleted by Act 55 of 1965).
(3) On the appointed day all the registers, books, indexes and other records in the possession or under the control of the RegistrarofDeedsoftheStateimmediatelybeforetheappointed 77National Land Code (Penang and Malacca Titles)
day under any Ordinance repealed by subsection (1) shall vest intheDirectorforthepurposes ofthisAct.
Power of the Minister to make orders
119. (1) The Minister may, after consultation with the State Authority,byorder--
(a) makesuchmodificationsinanypre-existinglawinforce in the State and relating to land which is not repealed undersection118asappeartohimnecessaryorexpedient
for the purpose of bringing such law into accord with thisAct;
(b) extendtotheStatetheSmallEstates(Distribution)Act 1955[Act 98],andmakesuchmodificationsthereinas
appeartohimnecessaryorexpedientforthepurposeof
bringingthatActintoaccordwiththisActandenabling
ittobefullyoperativeinrelationtotheState;
(c) exceptfromtheoperationofthisActanyartificialchannel orwatercourse;
(d) (Deleted by Act 55 of 1965);
(e) make such further or other provision as he may deem necessaryorexpedientforthepurposeofremovingany
difficultiesoccasionedbytheenactmentofthisAct.
(2) In paragraphs (1)(a) and (b) "modification" includes amendment,addition,adaptationandrepeal.
(3) Any order made under this section shall be published in theGazetteoftheStateandshallbepresentedtotheLegislative Assemblyassoonasmaybeafterpublication;andifaresolution is passed pursuant to a motion notice whereof has been given for a sitting day not later than the first available sitting day of theAssembly next after the expiry of one month from the date whensuchorderissopresentedannullingtheorderoranypart thereofasfromaspecifieddate,suchorderorsuchpartthereof, as the case may be, shall thereupon become void as from such date,butwithoutprejudicetothevalidityofanythingpreviously donethereunderortothemaking ofneworders.
78 Laws of Malaysia Act 518
Searches
120. (1) Any person may, on payment of such fee and subject tosuchconditionsasmaybeprescribed,inspectandtakenotes oforextractsfrom--
(a) the Interim Register or any instrument of dealing or application presented or made to or in the custody of theDirector;or
(b) theformerregistersandanydocumentoforiginaltitle orpre-existingdeedwhichisinthepossessionorunder
thecontroloftheDirector.
(2) The Director may refuse to make the Interim Register availableforinspectionundersubsection(1)whereheissatisfied that,byreasonofthepressureofbusinessorotherwise,itwould bedifficultorinexpedienttodoso:
Providedthat,ifhemakessucharefusalinrespectofaperson who is a bona fide prospective purchaser of a holding, he shall issuetothatpersononrequest(withoutanychargeotherthanthe fee payable under that subsection) a copy of the relevant folio ofthe InterimRegistermadebyphotographicorothersuitable means.
(3) Subject to subsection (6), any person may apply to the Director for an official search of the former registers and the Interim Register in respect of any holding, and where any such applicationismade--
(a) theapplicantshallsupplyinwritingsuchparticularsof the proposed search as are required by the Director; and
(b) theDirector,onreceiptoftheparticularsandtheprescribed fee, shall cause the search to be made and shall issue totheapplicantacertificateoftheresultofthesearch
oftheformerregisters;andeither--
(i) acertificategiving,withthenecessarymodifications, thesameinformationasacertificateissuedunder
section385oftheNational LandCode;or
79National Land Code (Penang and Malacca Titles)
(ii) ifhethinksfit,acopyoftherelevantfolioofthe
Interim Register made by photographic or other
suitablemeans.
(4)Subject to subsection (6), any person may apply to the Director for a copy of the folio of the Interim Register relating toaholding,andonreceiptofanapplicationinthatbehalfand theprescribedfeetheDirectorshallissuetotheapplicantacopy of the relevant folio made by photographic or other suitable means.
(5)Certificates and copies issued under this section shall be signedandsealedbytheDirectorandshallbereceivableinlegal proceedings as prima facie evidence of the matters contained therein.
(6)This section shall cease to apply in relation to a holding whenitstitlebecomesindefeasibleunderthisAct.
(7)In this section "the former registers" means all registers, books, records, indexes and other documents formerly in the possessionorunderthecontroloftheRegistrarofDeedsofthe State which are in the possession or under the control of the DirectorasaresultoftheoperationofthisAct.
Title in continuation and procedure on subdivision
121. (1) WhileaholdingisincludedintheInterimRegister,title incontinuationmaybeissuedas follows:
(a) title in continuation to the holding as a whole may be issued when the Director decides with respect to the relevantfoliooftheInterimRegister--
(i) at the time when he makes any entry thereon, thatthereisinsufficientspaceforthemakingof
furtherentries;or
(ii) at any time, that the folio can by reason of its physicalconditionnolongerbeused;
(b) title in continuation may be issued on subdivision as providedbysubparagraph(2)(b)(ii);
80 Laws of Malaysia Act 518
(c) titleincontinuationmaybeissuedonanychangesbeing made to the lot number of any holding under section 396oftheNationalLandCode;and
(d) titleincontinuationshallconsistofafreshfolioorfolios, asthecasemaybe,whichshallreplaceandshallbein
thesameformastheoriginalfolio.
(2) Where, in relation to a holding included in the Interim Register, a subdivision has been approved under Chapter 1 of Part Nine of the National Land Code and the title has become indefeasibleundersection85,then--
(a) ifthesurveyofthesubdivisionalportionsisnotcomplete, the Director shall cause the final document of title to theholdingtobeissuedassoonasreasonablypossible;
and
(b) ifthesurveyofthesubdivisionalportionsiscomplete, theDirectorshalleither--
(i) prepareandissuefinaldocumentsoftitleforeach
ofthem;or
(ii) ifheisrequestedtodosobytheproprietorofthe
holding, prepare and issue title in continuation
foreachoftheminthe InterimRegister.
(3) WheretheDirectorpreparesandissuesfinaldocumentsof title under subparagraph (2)(b)(i), he shall act as nearly as may be in accordance with the procedure prescribed by section 93, making such modifications as are necessitated by the fact that, inconsequenceofthesubdivision,morethanonefinaldocument of title are tobeissuedforthesubdividedholding.
Provision relating to State land, municipal streets, etc.
122. NotwithstandingPartIII,theDirectorshallnotberequired to enter in the Interim Register any State land, or any public street, public canal or public bridge, or any stream or river, or anyback-lane,whichimmediatelybeforetheappointeddaywas vestedinorsetapartforthepurposesoftheGovernmentofthe State,theCityCouncilofGeorgeTown,theMunicipalCouncillors of theTownandFortofMalaccaoranylocalauthority.
81National Land Code (Penang and Malacca Titles)
Transitional provisions relating to certain mortgages, etc.
123. (1) Any pre-existing agreement, covenant or undertaking to enter into a mortgage, charge or statutory mortgage of any land in the State shall, in relation to any period commencing on the appointed day, be construed and may be enforced as an agreement,covenantorundertaking,asthecasemaybe,toenter intoachargeofsuchlandpursuanttotheNationalLandCode. (2) Anypre-existingmemorandumoflienorchargeregistered undersection8oftheRegistrationofDeedsOrdinanceshallbe deemed to be and shall be entered upon the appropriate folio of the Interim register as a caveat subject to the National Land Code.
(3) NothinginthisActshallbedeemed--
(a) toprejudiceortoderogatefromtherightsofanyequitable mortgagee or chargee under any pre-existing equitable mortgageorcharge;or
(b) topreventthepresentationbyanypersonandtheregistration undertheNationalLandCodeofanycaveatarisingout
ofanypre-existingdeedorotherinstrumentreferredto
insubparagraph77(i),oroutofanypre-existingequitable mortgageorcharge.
(4) Fromtheappointeddayanypre-existingagreementtoconvey land in the State shall be construed and may be enforced as an agreementtotransferthelandundertheNationalLandCode. Transitional provision relating to subdivision of certain lands
124. (1) Whereanyholdinghas,priortotheappointedday,been thesubjectofasubdivisioneffectedbytheconveyanceofapart or parts of the holding, and the conveyed part or parts and the residueoftheholding(ifany)havenotontheappointeddaybeen delineatedonaplancertifiedbyoronbehalfoftheDirectorof Surveyaslotsdelimited(exceptasotherwiseprovidedinsections 29 and 30) by right-line boundaries, then the Director may, if heissatisfied--
(a) thataplanofsuchsubdivisionhasbeendepositedwith theRegistrarofDeedsbeforetheappointedday,orwith
82 Laws of Malaysia Act 518
theDirectoronorwithinonemonthaftertheappointed
day;and
(b) that such subdivision has been approved by any State or local authority charged with responsibility for the approval of such subdivision for the purposes of any law relating to local government or town and country planning,
openafoliooftheInterimRegisterinrespectofeachconveyed part and the residue of the holding (if any), and the conveyed partorpartsandtheresidue(ifany)shall,subjecttothissection, thereuponeachbedeemedtobeasingleholdingforthepurposes ofthisAct.
(2) Whenever any folio of the Interim Register is opened pursuant to subsection (1) the Director shall endorse each folio withthewords"Subdivisionundersection124",andeverysuch endorsement shall be deemed to constitute notice that the area and boundaries of the holding comprised therein have not been surveyedforthepurposesofthisAct.
(3) The Director shall, upon being satisfied that the holding comprisedinanyfolioreferredtoinsubsection(2)hasbeenduly surveyed for the purposes of this Act, cancel the endorsement made uponsuchfoliounderthesaidsubsection.
(4) The Director may exercise his powers under subsections (1),(2)and(3)inrespectofanyotherholdingifheissatisfied that--
(a) specific areas of such holding were, on the appointed day, being occupied by the respective registered
co-proprietors;and
(b) each occupied area is referred to in a document of original title in the possession of the co-proprietor or co-proprietors:
Providedthatnoapprovaloftheplanforsubdivisionshallbe necessary for the purpose of this subsection or for the purpose ofauthorizingthesurveyofthenewholdingssocreated.
(5) Notwithstanding the definition of the word "holding" in subsection 4(1), the Director may exercise powers under 83National Land Code (Penang and Malacca Titles)
subsections (1), (2) and (3) in respect of any unsurveyed land which represents the combined areas of two or more holdings if he is satisfied that such act is necessary for or in connection withtheregistrationofapre-executedinstrument.
(6) No folio in the Interim Register may be opened by the Directorundersubsection(1)foranypartofthesaidunsurveyed landunlessthefollowingconditionsaresatisfied:
(a) that the amalgamation of two or more holdings has been duly approved by the proper authority before the appointedday;and
(b) that the application for amalgamation survey has been lodgedwiththeappropriateauthority.
84 Laws of Malaysia Act 518
FIrst schEduLE
FORMS
Form a--DELEGATIONBYTHEDIRECTOR
[Subsection9(2)]
In exercise of the powers conferred on me by subsection 9(2) of the National Land Code (Penang and Malacca Titles) Act 1963, I delegateto........................................................................................................ ....................................................... .......................................................................................................................... *subjectto thefollowingconditionsandrestriction:.................................... .......................................................................................................................... *andgenerally/withrespecttothefollowingholding:............ Datedthis..............dayof..........20.... .................................. Director of Land Titles
*Amendasnecessary.
FormB--APPLICATIONFORAPPEALTOTHEBOARD
[Section15]
TotheSecretarytotheLandTitlesAppealBoard,
.................................................................. PursuaNt to section 15 of the National Land Code (Penang and Malacca Titles)Act1963,IappealagainstthefollowingdecisiongivenbytheDirector ofLandTitlesonthe.....................dayof...........................20...... (here set out the substance of the decision)
onthefollowinggrounds,namely:
(here set out the substance of the grounds of appeal)
2. Iadducethefollowing documentsinsupportofmyappeal: (here set out list of documents)
*allthepowersconferredonmebythisAct
*thefollowingpowersconferredonmebythisAct
85National Land Code (Penang and Malacca Titles)
andampreparedtocallthe followingwitnessesinsupportthereof: (here specify names and addresses of witnesses)
Datedthis...........dayof................................20.... .............................................................. Signature of person aggrieved or his
advocate and solicitor
Address ............................................ .............................................................
FormC--APPLICATIONCONCERNINGBOUNDARIES
[Section28]
To theDirectorofLandTitles,
............................................................... PursuaNt to section 28 of the National Land Code (Penang and
Malacca Titles) Act 1963, I, .......................................................... .......................................................................................... (full name) o f ... ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .( a d d re s s ) claim that the boundary marks relating to the following holding: ............................................................................................... (here include a reference to the lot number and description of the holding) isincorrectlyplaced.
2. Myinterest inthesaid holdingisasfollows: (here specify nature of interest)
andthefollowingarethegroundsofmyclaim:
(here specify such grounds)
3. Iadduce thefollowingevidenceinsupportofmyclaim: (here specify such evidence and annex to the application any documents in support thereof and the names and addresses of any witnesses supporting the application)
Datedthis................dayof....................................20..... .................................................. Signature of claimant or his
advocate and solicitor
86 Laws of Malaysia Act 518
FormD--FORMOFINTERIMREGISTER
[Paragraph31(3)(b)]
Area....................... HOLDINGNo.................................. SurveyParticulars............................................................................................ .......................................................................................................................... Original Replacement
Tenure........................................... Title.................................................... Registered.................................................................................................... Mortgages................................................................................................... orLeases.................................................................................................... OtherKnownIncumbrances........................................................................... Proprietor or .................................................................................................... Proprietors .................................................................................................... ......................................
Registry Officer
Titlecontinuedinregister...............................................enteredthisday. .......................................
Director of Land Titles
FormE--CLAIMRELATINGTOREPLACEMENTTITLE
[Subsection53(1)]
TotheDirectorofLandTitles,
..................................................................... PursuaNt to section 53 of the National Land Code (Penang and Malacca Titles) Act 1963, I, ...................................................................................... .................................................................................................. (full name) of ...............................................................................(address) claimthat--
(here insert substance of claim, in conformity with subsection 53(1))
87National Land Code (Penang and Malacca Titles)
2. Thefollowingarethegroundsformyclaim: (here specify such grounds)
and Iadduce thefollowingevidenceinsupportthereof: (here specify such evidence)
3. Ibelieve thatthefollowingpersonsmaybeaffectedbythisclaim: (here insert names and addresses of such persons) Datedthis.................dayof...........................20....... ..........................................
Signature of claimant or his
advocate and solicitor
Form F--NOTICEOFCLAIM
[Subsection53(3)]
To
........................................................... In exercise of the powers conferred on me by subsection 53(3) of the NationalLandCode(PenangandMalaccaTitles)Act1963,Igivenoticethat aclaimhasbeenmadeunderthesaidsectioninrespectof.......................... ....................................................(here specify the lands or interests affected) by...........................................................................(here specify the claimant).
2. Thefollowingarethegroundsofsuchclaim,andtheevidenceinsupport thereof:
(here specify such grounds and evidence)
3.Onthe...............dayof...................................................20....... IendorsedupontheappropriatefoliosoftheInterimRegisteranoticeofsuch claim, in accordance with subsection (2) of the said section, in consequence whereofeverypersondealingwiththeholdingscomprisedthereinisdeemed todealwithitsubjecttoandwithnoticeof suchclaim.
4. Inaccordancewithsection54ofthesaidActyoumayeitheradmitsuch claim or, within one month of the date on which this notice is served upon you, object thereto, in which event an enquiry will be held pursuant to the saidAct.
5. InconsequenceIshallbegratefulifyouwillinformme,bywriting,on orbeforetheexpirationofonemonthfromthedateofserviceofthisnotice uponyou,whetheryouadmitorobjecttosuchclaim.Intheeventofobjection, Ishallalsobegratefulifyouwillsubmitthegroundsforyourobjectionand anote ofanyevidenceinsupportthereof.
Datedthis.................dayof..................20............. ...................................
Director of Land Titles
88 Laws of Malaysia Act 518
Form G--REFERENCEBYTHEDIRECTOR
[Subsection55(1)]
Inthematterofsection55oftheNationalLandCode(Penangand MalaccaTitles)Act1963,andin the matterof.............................. TotheRegister,HighCourt,
...................................................... REFERENCE BYTHEDIRECTOR
WhErEas a claim has been made to me under section 53 of the National Land Code (Penang and Malacca Titles)Act 1963, details of which are set outinthecopythereofhereunto annexed:
(Annexure A: Copy of Form E):
aNd WhErEas aquestionhasarisen insuchclaimconcerning-- (here specify, with details, the question that has arisen, in accordance with subsection 55(1))
aNd WhErEas Iconsiderthatsuchquestioncannotbedisposedofbymein exerciseofthepowersconferredonmebyPartIIofthesaidAct: aNd WhErEas Ihaveservednoticeonthefollowingpartiesinterestedtherein in theformsetoutinthe copy/copiesthereofhereuntoannexed: (Annexure B: Copy of Form F):
(here specify names and addresses of parties)
aNd WhErEas inaccordancewithsubsection55(2)ofthesaidActIhaveon thisdayenteredacaveatupontheappropriatefoliooftheInterimRegister, viz............................................................................................................... (here include details of folios/and holdings affected) Now therefore IN EXErcIsE of the powers conferred on me by subsection 55(1) of the said Act I refer the foregoing question to the Court for its considerationinaccordancewiththesaidsection.
Datedthis................dayof.....................................20...... .................................
Director of Land Titles
89National Land Code (Penang and Malacca Titles)
Form h--MEMORANDUM OF DISCHARGE
[Section65]
PresentationNo.................
MEMORANDUMOFDISCHARGE
Replacementmortgage/chargeNo................................................... onthelandcomprisedin.................................................................. has been discharged upon payment of the sum of................................ ..........................................................ringgit.........................................sen (the receipt whereof is hereby acknowledged) in satisfaction and discharge thereof.
Datedthis................dayof...............................20.... ...........................................
Signature of mortgagee or chargee
MemorialmadeintheInterimRegister................................................. ............this................dayof.............................20... .................................
Registrar
FormI--NOTICEBYDIRECTORRELATING
TOINDEFEASIBILITY
[Subsection84(2)]
NOTICEBYTHEDIRECTOROFLANDTITLES
WhErEasIamsatisfiedofthevalidityofthereplacementtitle/titlestothe holding/holdings described in the Schedule hereto, together with the names andaddressesoftheproprietorsthereof:
aNd WhErEas suchreplacementtitle/titlesappeartobeindefeasibleforthe purposesoftheNationalLandCode(PenangandMalaccaTitles)Act1963: Now therefore IN EXErcIsE oF the powers conferred on me by subsection 84(2) of the saidAct I rEquIrE any person claiming any interest adverse to the title of such registered proprietor/proprietors (and whether or not any suit, action or proceeding has been brought in respect of any such claim) to presentacaveatinsupportofsuchclaimwithinsixmonthsfromthedateof publicationofthisnotice.
90 Laws of Malaysia Act 518
NotIcE is hereby given that failing presentation of any caveat in due time thetitle/titlesdescribedwillbecomeindefeasible.
Datedthis............... dayof........................20.... ...................................
Director of Land Titles
thE schEduLE aboVE rEFErrEd to
Description of Name and addresses of Replacement title holding proprietor
FormJ--APPLICATIONFOREXAMINATIONOFTITLE
[Paragraph 87(2)(a)]
TotheDirector ofLandTitles,
WhErEasI,..................................................... (name and address) am registered in the Interim Register as the proprietor of the following holding:.................................................................................... (here specify holding):
*aNd WhErEas Iamseekingapprovalforasubdivisionofsuchholding: NowthereforePursuaNt tosection87oftheNationalLandCode(Penang andMalaccaTitles)Act1963,Iapplyforanexaminationofthereplacement titletosuchholdingandencloseherewith--
(a) allthepre-existingdeedsrelatingtosuchholdinginmypossession orundermy control,andofwhichalistisannexedhereto; (b) afullabstractoftitletheretopreparedandcertifiedbyanadvocate andsolicitoranddeducedfortheperiodspecifiedinsubsection82(2) ofthesaidAct.
Datedthis..............dayof..............................20........... ...........................
Applicant
*Deleteifinapplicable.
91National Land Code (Penang and Malacca Titles)
FormK--APPLICATIONFORDELIVERYOF
DOCUMENTS, ETC.
[Section91]
TotheDirectorofLandTitles,
WhErEas I am the proprietor of/have the following interest, viz .......................................................................................... in* the following holding ............................................................ aNd WhErEas the *document/instrument specified in the Schedule hereto relating to the said holding have been impounded under section 90 of the NationalLandCode(PenangandMalaccaTitles)Act1963:
aNd WhErEassuch*document/instrumentisofhistoricalinterest/shouldnot be impoundedforthefollowingreason(s)........................................ (here specify reasons in support of application): Now therefore PursuaNt to section 91 of the said Act I apply for the deliverytomeofsuch*document/instrument.
Datedthis..................dayof.......................20...... ............................
Applicant
*Amend asnecessary.
FormL--ADVANCECERTIFICATEOFTITLE
[Paragraph92(1)(a)]
thE statE oF .........................
ADVANCECERTIFICATEOFTITLE
HoldingNo.......................................................................................
The replacement title to the land comprised in the above holding is indefeasiblewith effectfromthe............dayof.......................................... 20..................Induecourseafinaldocumentoftitlewillbeissuedinthe formof.................................................................................................... Mukim
Township
92 Laws of Malaysia Act 518
At the time of the issue of this certificate the registered title and interest are: Proprietor.............................................................................. Charges................................................................................. Leases .................................................................................. KnownIncumbrances ............................................................... ........................................
Director of Land Titles
FormM--NATIONALLANDCODE(PENANGANDMALACCA
TITLES)ACT1963
NotIcE to a comPaNy to rEstorE ItsELF as a
maLacca customary LaNd comPaNy
[Section 108b]
To................................................... of.................................................... Proprietorofthelandscheduledbelow.
Whereas, I, the undersigned, am satisfied that you have ceased to be a MalaccaCustomaryLandcompanyinthat--
.................................................................................................... .................................................................................................... .................................................................................................... (Here describe how the company has ceased to be a Malacca Customary Land company).
Now, therefore, in exercise of the powers conferred by section 108b of the National Land Code (Penang and Malacca Titles) Act 1963, I require youwithinaperiodof....................................................fromthedate of this notice to take the following action to restore yourself as a Malacca CustomaryLandcompany:
.................................................................................................... .................................................................................................... Datedthis ................dayof..............20.......... ....................................
Land Administrator
(L.S.)
District of....................
93National Land Code (Penang and Malacca Titles)
schEduLE oF LaNd
*Town/Village/Mukim.........................*Lot/L.O.No.......................... DescriptionandNo.ofTitle...........................Area........................... *Deleteasappropriate.
FormN
NATIONAL LANDCODE(PENANGAND MALACCATITLES)
ACT1963
NotIcE to shoW causE
[Section108c]
To............................................... of................................................ Proprietorofthelandscheduledbelow.
Whereas, I, the undersigned, am satisfied that you have ceased to be a MalaccaCustomaryLandcompanyinthat--
.......................................................................................................................... .......................................................................................................................... .......................................................................................................................... (Here describe how the company has ceased to be a Malacca Customary Land company).
Andwhereas--
*(a) Iamoftheopinionthatthetakingofactionundersection108bof the National Land Code (Penang and Malacca Titles) Act 1963, wouldnotbeappropriate;
*(b) you have failed to comply with the notice served on you under section 108b of the National Land Code (Penang and Malacca Titles) Act 1963, requiring you to restore yourself as a Malacca CustomaryLandcompany.
Now, therefore, in exercise of the powers conferred by section 108c of theNationalLandCode(PenangandMalaccaTitles)Act1963,Irequireyou to appear before me on the ................... day of .............. 20 ......... 94 Laws of Malaysia Act 518
at...................hoursat.....................................toshowcausewhyI shouldnotforthwithdeclarethe landforfeittotheStateAuthority. Datedthis..............dayof...........................20.............. ..............................
Land Administrator
(L.S.)
District of............................
schEduLE oF LaNd
*Town/Village/Mukim................................*Lot/L.O.No........................... Description andNo. ofTitle........................Area............................ suPPLEmENt
To................................................ of................................................ *Chargee/Lessee/Sublessee/Tenant/Lienholder/Caveator takE NotIcE that if you wish to show cause why the above land should not be declared forfeit, you should appear at the time and place specified above.
Datedthis .................dayof.......................20...... ..............................
Land Administrator
(L.S.)
District of............................
*Deleteasappropriate.
FormO
NATIONALLANDCODE(PENANGANDMALACCATITLES)
ACT1963
NotIcE oF rEVErsIoN to thE statE authorIty
[Section108d]
Whereas, pursuant to section 108c of the National Land Code (Penang and Malacca Titles)Act 1963, the land scheduled below has by order been declaredforfeittothe StateAuthority.
95National Land Code (Penang and Malacca Titles)
Notice is given that such forfeiture has this day taken effect and that, in consequence of the saidlandvestingintheStateAuthority-- (a) any title or interest in the land heretofore subsisting or capable of arisingisextinguished;and
(b) theissuedocumentoftitletothelandisvoidandisimpoundableby theState.
Datedthis..................day of.........................20.... ......................................
Land Administrator
(L.S.)
District of .................................
schEduLE oF ForFEItEd LaNd
*Town/Village/ *Lot/L.O.No. Description and No. Area Mukim ofTitle
*Deleteas appropriate.
sEcoNd schEduLE
(Deleted by Act 55 of 1965)
thIrd schEduLE
[Section45]
CONDITIONSOFREPLACEMENTTITLES
1. Where a pre-existing grant or lease was issued after the first day of January 1936, the replacement title shall not be subject to any condition underthisSchedule.
96 Laws of Malaysia Act 518
2. Wherethepre-existingtitle,notbeingonetowhichparagraph3applies, was issued not later than the first day of January 1936, the replacement title shall be subject to the following condition, which shall be known as ConditionA:
"Thelandcomprisedinthistitleshallnotbeaffectedbyanyprovision oftheNationalLandCodeoranyotherwrittenlawprohibitingmining or the removal of specified materials beyond the boundaries of the land, except a provision prohibiting the prospecting for and extraction ofmineraloil.".
3. Where the pre-existing title was granted before the fourth day of May 1907,thereplacementtitleshallbesubjecttothefollowingcondition,which shallbeknownasConditionB:
"Thelandcomprisedinthistitleshallnotbeaffectedbyanyprovision oftheNationalLandCodeoranyotherwrittenlawprohibitingmining or the removal of specified materials beyond the boundaries of the land.".
4. Wherethepre-existingtitlewasgrantedbefore the second day of December 1915, then, in the absence of an express condition thereon making the land subjecttore-entryforthepurposesofarightofway,thereplacementtitleshall be subject to the following condition additional to that set out in paragraph 2or3,whichshallbeknownasConditionC:
"Thelandcomprisedinthistitleshallnotbeaffectedbyanyprovision of the National Land Code limiting the compensation payable on the creation of a Land Administrator's right of way to compensation for damageinrespectoftrees,cropsorbuildings.".
5.Paragraphs1to4shallnotapplyinrespecttoagrant(firstgrade),which shallinsteadbesubjecttothefollowingcondition:
"Thelandcomprisedin thistitle--
(a) shall not be affected by any provision of the National Land Code limiting the compensation payable on the exercise by the State Authority of a right of access or use conferred by Chapter 3 of Part Three of the Code or on the creation of a LandAdministrator'srightofway;and
(b) subjecttotheimpliedconditionthatlandisliabletobere-entered if it is abandoned for more than three years, shall revert to theStateonlyiftheproprietorforthetimebeingdieswithout heirs,
andthetitleshallconfertheabsoluterighttoallforestproduceandto alloil,mineralandothernaturaldepositsonorbelowthesurfaceofthe land(includingtherighttoworkorextractanysuchproduceordeposit andremoveitbeyondthe boundaries oftheland)."
97National Land Code (Penang and Malacca Titles)
Fourth schEduLE
[Section64]
PartI--GENERAL
Interpretation
1. InthisSchedule, unlessthecontextotherwiserequires-- "charge"includesmortgage;
"issuedocumentoftitle"includes,inrelationtoanyholdingtowhichthe titlehasnotyetbecomeindefeasibleunderthisAct,allthepre-existingdeeds relatingto thetitletosuchholding;
"land"includesanyimmovableproperty;
"Part"meansaPartofthisSchedule;
"prescribed form" means any form prescribed by or under thisAct or, if nosuchformissoprescribed,anyformprescribedbyorundertheNational LandCode;
"Register"meanstheInterim Register.
Saving relating to contract
2. NothinginthisScheduleshallbedeemedtoderogatefromanyremedythat maybeavailabletoanychargeeunderanychargepursuanttoanycontractual obligation.
3. (Deleted by Act 55 of 1965).
4. (Deleted by Act 55 of 1965).
5. (Deleted by Act 55 of 1965). PartII--POWERSOFCHARGING
6. (Deleted by Act 55 of 1965).
7. (Deleted by Act 55 of 1965). PartIII--IMPLIEDCONDITIONS
8. (Deleted by Act 55 of 1965).
9. (Deleted by Act 55 of 1965). 98 Laws of Malaysia Act 518
PartIV--POWEROFSALE
Notice of sale
10. (1) Ifdefaultis made-- (a) inthepaymentoftheprincipalsum,interest,annuityorrent-charge, or anypartthereof,securedbyanycharge;or
(b in the observance of any covenant or condition expressed in the memorandumofchargeorimpliedthereinunderthisAct,
and such default is continued for the space of one month, or for such other period as may be expressed in the memorandum of charge, the chargee may serveuponthechargor a noticeintheprescribedform.
(2) Any noticeservedundersubparagraph(1)shall--
(a) specifythefollowingparticulardefaultordefaultsthatmayhavebeen made:
(i) defaultinthepaymentoftheprincipalsum,interest,annuityor rent-charge,oranypartthereof,securedbythecharge;or (ii) defaultintheobservanceofanycovenantorconditionexpressed in the memorandum of charge or implied therein under this Act;
(b) requirethechargorwithinonemonth,orsuchotherperiodasmay beexpressedinthememorandumofcharge--
(i) topayallthemoneythendueorowingonsuchmemorandum ofcharge; or
(ii) to observe the covenants and conditions therein expressed or implied;and
(c) warnthechargorthatindefaultofcompliancetherewithasaleofthe landwillbeeffected.
(3) Wheneveranymoneyissecuredbyamemorandumofcharge,andsuch sumisbysuchmemorandummadepayableondemand--
(a) such demand shall be made by serving upon the chargor a written noticeintheprescribedform;
(b) such notice may be served on the chargor although no default in paymenthasbeenmade.
(4) Any notice served under subparagraph (1) or (3) shall be served in the manner prescribed by the National Land Code for the service of notices thereunder.
Transfer after notice
11. Ifaftertheserviceofanynoticeunderparagraph10thelandcomprised in the memorandum of charge referred to therein is transferred subject to suchmemorandumofcharge,thensuchnoticeshallbeasvalidandeffectual 99National Land Code (Penang and Malacca Titles)
againstanysubsequentproprietorofsuchlandasagainsttheoriginalchargor thereof.
Protection of purchaser
12. (1) Thereceiptorreceiptsinwritingofachargeeexercisinganypower of sale conferred hereunder shall be a sufficient discharge to any purchaser of any land, parcel or interest sold pursuant to paragraph 16 for so much of hispurchasemoneyasmaybetherebyexpressedtobereceived. (2) Nopurchaserreferredtoinsubparagraph(1)shallbeanswerableforany loss,misapplicationornon-application,orbeobligedtoseetotheapplication ofthepurchasemoneypaidbyhim,norshallhebeconcernedtoenquireas tothefactofany default ornoticehavingbeenmadeorgivenasaforesaid. Application of purchase money
13. ThepurchasemoneyarisingfromanysaleunderthisScheduleshallbe applied--
(a) firstly,inpaymentofanyrentorfeesduetotheState; (b) secondly,inpaymentoftheexpensesoccasionedbysuchsale; (c) thirdly,inpaymentofthemoneyswhichmaythenbedueorowing tothechargee;
(d) fourthly, in payment of subsequent charges, if any, in the order of theirpriority,
andthesurplus,ifany,shallbepaidtothechargor.
Powers under Part V to be additional to power of sale
14. The powers conferred upon a chargee by this Part may be exercised withoutprejudicetoPartV,andnochargeeshallbedebarredfromexercising anysuchpowersbyreasonofthefact--
(a) thathemayinsuchcircumstancesexerciseanypowersconferredon himbyPartV;or
(b) that he has already exercised or is exercising any of the powers conferredonhimbyPartV.
Chargee not answerable for involuntary loss
15. A chargee shall not be answerable for any involuntary loss happening in or about the exercise or execution of the power of sale conferred by this Scheduleorofany trustconnectedtherewith.
100 Laws of Malaysia Act 518
Power of sale, etc.
16. (1) Whereanydefaultinpaymentorintheobservanceofanycovenant orcondition,asthecasemaybe,continuesfortheperiodofonemonthafter theserviceofanynoticeunderparagraph10,orforsuchotherperiodasmay bespecifiedinthememorandumofcharge,thechargeeshallbeatlibertyto sellandisauthorizedandempowered, inaccordancewiththisAct-- (a) tosellthelandcharged,oranyparcelthereofwhichisunderaseparate titleorwhichhasbeendulysurveyedforthepurposesofsubdivision, and all the interest therein of the chargor, either by public auction orprivatecontract,andsubjecttosuchconditionsashemaythink fit;
(b) to buy in and resell such land without being liable for any loss occasionedthereby;
(c) tomakeandexecuteallsuchinstrumentsasshallbenecessaryfor effectingthesaleofsuch land.
(2) Allsales,contracts,mattersandthingsauthorizedundersubparagraph (1)shallbeasvalidandeffectualasiftheyhadbeenmade,doneorexecuted bythechargor.
Notice of sale
17. (1) A chargee at liberty to sell may prepare a notice in the prescribed form declaring that he will sell the charged land on or after a specified day whichshallnotbelessthanonemonthfromthedateoftheserviceofsuch noticeuponthechargor.
(2) Everynoticepreparedundersubsection(1)shallbeservedon-- (a) thechargor;
(b) everyotherchargee,whetherornothischargeispriororsubsequent tothatofthechargeeservingsuchnotice;
(c) theRegistrar.
Tender after notice of sale
18. (1) At any time before the date specified in any notice served under subparagraph17(1)thechargororanychargeereferredtoinsubsubparagraph (2)(b) ofsuchsectionmaytendertothechargeepreparingsuchnotice;orto any auctioneer or agent acting in his behalf, payment of all the outstanding sumssecuredbythecharge,togetherwithallinterestduethereonandallthe costsincurredbythechargeeinproceedingsunderthisAct. (2) Whereany payment undersubsection(1)istendered-- (a) bythechargorthechargeeshalluponreceiptthereofdischargethe charge;
101National Land Code (Penang and Malacca Titles) (b) byanychargeereferredtoinsubsubparagraph17(2)(b) thechargee shalluponreceiptthereoftransferthechargetothechargeemaking suchpayment.
Registrar to give effect to sale by chargee
19. (1) Upon the completion of any sale under this Part the chargee shall transfer the land sold to the purchaser by completing a memorandum of dealingintheprescribedform.
(2) The Registrar shall register any memorandum of dealing executed by achargeepursuanttosubparagraph(1),anduponsuchregistrationtheestate orinterestofthechargor,asthereindescribedtobetransferred,shallpassto and vest in the purchaser freed and discharged from all liability on account ofsuchcharge orof anychargeregisteredsubsequentthereto. PartV
POWERTOENTERINTOPOSSESSION
Powers not to prejudice power of sale
20. The powers conferred upon a chargee by this Part may be exercised withoutprejudicetoPartIV.
Power to enter into possession
21. (1) Ifdefaultismadeinthepaymentoftheprincipalsum,interest,annuity or rent-charge, or any part thereof secured by any charge, and such default iscontinuedforthespaceofonemonth,orforsuchotherperiodasmaybe expressedinthememorandumofcharge,thechargeemayafterservingupon the tenant or occupier or other person liable to pay or account for the rents and profits thereof a notice in the prescribed form, enter into possession of thechargedlandorany partthereof--
(a) byreceivingtherentsandprofitstherefor;or
(b) byappointingareceiveroftheincomeofthesaidland. (2) Upon the service of any notice pursuant to subparagraph (1) all the powers and remedies of the chargor in regard to the receipt and recovery of and the giving of discharges for any rents and profits (including any rents due but not paid prior to the service of such notice) shall be suspended and transferred to the chargee or receiver, as the case may be, and such notice shallcontinuein force,until--
(a) thenoticeiswithdrawnbythechargee;or
(b) the charge shall be satisfied and the discharge thereof duly registered.
102 Laws of Malaysia Act 518
Effect of entry into possession
22. During the continuance in forceofanynoticeunderparagraph21-- (a) the receipt in writing of the chargee or receiver, as the case may be, shall be a sufficient discharge for any rents and profits therein expressedashavingbeenreceived;
(b) no person paying such rents and profits shall be bound to enquire concerning any default or other circumstance affecting the right of the person giving such notice beyond the fact of his being duly registeredaschargeeoftheland;
(c) anypersonwhoincontraventionofsuchnoticeshallpayanyrents orprofitstothechargorshallnotwithstandingsuchpaymentremain liabletothechargeeorreceiver,asthecasemaybe,forthewhole of anysuchrentsorprofits;
(d) apersonpayingmoneytothechargeeorreceivershallnotbeconcerned to inquire whether any case has happened to authorize the chargee or receivertoact;
(e) anyrentsand profitsreceivedshallbeapplied--
(i) indischargeofallrents,taxes,ratesandoutgoingsaffectingthe chargedland;
(ii) in keeping down all annual sums or other payments, and the interestonallprincipalsums,havingprioritytothechargein rightwhereofsuchrentsandprofitsarereceived;
(iii) inpaymentofanycommission(notexceedingfivepercentum onthegrossamountofallmoneyreceived)duetothereceiver, if any;
(iv) in payment of the premiums on any fire or other insurances properly payableunderthememorandumofcharge;
(v) inpaymentofthecostofexecutingnecessaryorproperrepairs under thememorandumofcharge;and
(vi) inpaymentoftheinterestaccruingdueinrespectofanyprincipal sum dueunderthecharge,
andtheresiduethereofshallbepaidtothepersonwho,butfortheentryinto possession upon the charged land, would have been entitled to the income thereof,orwhoisotherwiseentitledtosuchland.
Chargee of leasehold land in possession liable to lessor
23. Any chargee of leasehold land, or any person claiming such land as a purchaser or otherwise from or under such chargee shall, after entering into possession of any such land during such possession (but only to the extent of any benefit, rents or profits received by him) become and be subject and liabletothelessorofsuchland,ortothepersonforthetimebeingentitled 103National Land Code (Penang and Malacca Titles) tosuchlessor'sestateorinteresttherein,tothesameextentasthelesseeor tenantwassubjecttoandliablethereforpriortosuchchargeeorotherperson enteringintopossessionofthesaidlandorthereceiptoftherentsandprofits thereof.
Saving relating to orders of Court, etc.
24. Nothingin thisPartshall-- (a) interferewiththeeffectofanyrule,orderorjudgmentofanyCourt inregardtothepaymentofrentunderthespecialcircumstancesof any case; or
(b) prejudiceanyremedyofthechargoragainstthechargeeforwrongful entryintopossessionorforanaccount.
25. (Omitted). PartVI--DISCHARGE
26. (Deleted by Act 56 of 1965).
27. (Deleted by Act 56 of 1965).
28. (Deleted by Act 56 of 1965).
29. (Deleted by Act 56 of 1965). FIFth schEduLE
[Section118]
REPEALS
Ordinance Extent of Repeal
Cap.115 ResumptionofCrown ThewholeOrdinance
Rights,Malacca,
Ordinance
Cap.118 ConveyancingandLaw PartsII, III,IV,V,XI, of PropertyOrdinance (excludingsections
62to66),XIIIandXV
Cap.121 RegistrationofDeeds Thewhole Ordinance
Ordinance
Cap.126 MutationsinTitlestoLand ThewholeOrdinance Ordinance
104 Laws of Malaysia Act 518
Cap.127 MalaccaLandsOrdinance ThewholeOrdinance
Cap.130 BoundariesandSurvey ThewholeOrdinance
Maps Ordinance
Cap.132 MalaccaRe-Surveys ThewholeOrdinance
Ordinance
35of1938 BodiesCorporate(Joint ThewholeOrdinance Tenancy)Ordinance1938
57of1950 PenangCorrected ThewholeOrdinance
Re-Surveys Ordinance
1950
sIXth schEduLE
[Section108]
PERSONSTOWHOM ORBODIESTOWHICHLAND SUBJECT
TO PARTVIIIMAYBECHARGED
1. MinisterofFinance.
2. FederalLandsCommissioner.
3. MajlisAmanahRakyat.
4. TheHousingTrust.
5. BankBumiputraMalaysiaBerhad.
6. Bank PembangunanMalaysiaBerhad.
7. LembagaPadidanBerasNegara.
8. BumiputraMerchant BankersBerhad.
9. Malayan BankingBerhad.
10. BankPertanian.
11. BankKerjasamaRakyatMalaysia.
12. PetroliamNational Berhad.
13. SouthernBankBerhad.
14. PublicBankBerhad.
15. MalaysiaBorneoFinanceCorporation(M)Berhad.
16. SabahBankBerhad.
17. TheCo-OperativeCentralBankLtd. 18. LembagaPelabuhanKelang.
Ordinance Extent of Repeal
105National Land Code (Penang and Malacca Titles) 19. KoperasiGuru-GuruMelayuMelakaBerhad.
20. Petronas DaganganSdn.Bhd.
21. YayasanMelaka.
22. PerwiraHabibBank.
23. PerbadananKemajuanNegeriMelaka.
24. Lembaga LetrikNegara.
25. PerbadananPembangunanBandar.
26. Lembaga PemulihandanPenyatuanTanahNegara.
27. BankIslam.
28. Setiausaha Kerajaan Melaka.
29. PembangunanPertanianMelakaSdn.Bhd.
30. RubberIndustrySmallholdersDevelopmentAuthority(RISDA). 31. Chung Khiaw Bank.
32. UnitedMalayanBankingCorporationBhd.
33. UnitedAsianBank.
34. TheMalayanFinanceCorporationBhd.Ltd.
35. Malayan UnitedFinanceBhd.
36. PublicFinanceBhd.
37. MalaysiaBuildingSocietyBhd.
38. KewanganBumiputraBerhad.
39. MalaysiaNationalInsuranceSdn.Bhd.
40. TalascoInsuranceSdn.Bhd.
41. MajlisPerbandaranMelakaTengah.
42. TheOrientalBank.
43. TheGovernmentof Malaysia(KerajaanMalaysia).
44. MajlisAgamaIslamMelaka.
45. PermodalanNasionalBerhad(PNB).
46. HeavyIndustriesCorporationofMalaysiaBhd.(Hicom). 47. OverseaChineseBankingCorporationLimited.
48. KwongYik BankBerhad.
49. KoperasiPolisDiraja(Malaysia)Bhd.
50. Kewangan Usaha BersatuBerhad.
51. LeeWahBank.
106 Laws of Malaysia Act 518
52. LembagaUrusandanTabungHaji.
53. AmanahInternationalFinanceSdn.Bhd.
54. MalaysianInternational FinanceBerhad.
55. MalaysianFrenchBankBerhad.
56. ArabMalaysianMerchantBankBerhad.
57. Arab MalaysianFinanceBerhad.
58. MalaysiaCreditFinanceBerhad.
59. KoperasiWanitaMelakaBerhad.
60. ThePacificBankBerhad.
61. KoperasiPekerja-PekerjaMelayuMelakaBhd.
62. ESSOMalaysiaBhd.
63. KumpulanGuthrieSdn. Bhd.
64. StateSecretarySelangor(Incorporation).
65. DevelopmentandCommercialBankBhd.
66. VisiaFinanceBhd.
67. KompleksKewanganMalaysiaBhd.
68. Lembaga KumpulanWangSimpananPekerja.
69. UMBCFinanceBhd.
70. CagamasBhd.
71. PETMALSdn.Bhd.
72. BankUtama(Malaysia)Bhd.
73. UtusanMelayu(Malaysia)Bhd.
74. CempakaFinanceBhd.
75. PerbadananKemajuanGetahMalaysiaBhd.(MARDEC). 76. SyarikatTelekomMalaysiaBhd.
77. SHELLMalaysiaTradingSdn.Bhd.
78. KCBFinance Bhd.
79. D&C FinanceBhd.
80. AffinFinanceBhd.
81. MalaysianIndustrialDevelopmentFinanceBhd.(MIDF). 82. MUIBankBerhad.
83. MBFFinanceBhd.
84. CALTEXOilMalaysia Limited.
107National Land Code (Penang and Malacca Titles) 85. BankSimpananNasional.
86. TenagaNasionalBhd.
87. TelekomMalaysiaBhd.
88. BankofCommerce(M)Berhad.
89. KewanganIndustri Berhad.
90. MaybanFinanceBerhad.
91. OrientalBankBerhad.
92. MobilOil MalaysiaSdn.Bhd.
93. PerbadananKemajuanTanahAdatMelaka.
94. HongkongandShanghai BankingCorporationLimited. 95. LembagaPengelolaDewan BahasadanPustaka.
96. OrientalFinanceBerhad.
97. BBMBKewanganBerhad.
98. PetronasDagangan Berhad.
99. TheMalaysianCo-operativeInsuranceSocietyLtd. 100. Hongkong BankMalaysia Berhad.
101. ChungKhiawBank(Malaysia)Berhad.
102. KoperasiMuslimMalaysiaBerhad.
103. PertubuhanKeselamatanSosial.
104. OCBCBankMalaysiaBerhad.
105. UnitedMerchantFinanceBerhad.
106. BankIslamMalaysiaBerhad.
107. Arab MalaysianEagleAssuranceBerhad.
108. PersatuanNelayanKawasanMelaka.
109. UnitedOverseasBank(Malaysia)Berhad.
110. HongLeongFinance Berhad.
111. PerwiraAffinBankBerhad.
112. EONFinanceBerhad.
113. BSNCommercialBankMalaysiaBerhad.
114. Arab-MalaysianAssuranceBerhad.
115. KewanganBersatuBerhad.
116. PerbadananUsahawanNasionalBerhad.
117. DCBBankBerhad.
118. AmanahMerchant Bank Berhad.
108 Laws of Malaysia Act 518
119. KwongYikFinanceBerhad.
120. AlliedBank (Malaysia)Bhd.
121. Multi-PurposeFinanceBerhad.
122. Arab-MalaysianBankBerhad.
123. EONBank Berhad.
124. KetuaMenteriMelaka.
125. KoperasiMajlisAgamaIslamMelaka.
126. PembangunanPembinaanMelakaSdn.Bhd.
127. OverseasUnionBank(Malaysia)Berhad.
128. SimeBankBerhad.
129. BSNFinanceBerhad.
130. PerwiraAffinMerchantBankBerhad.
131. PhileoAlliedBank(Malaysia)Berhad.
132. RHBFinanceBerhad.
133. BankPertanianMalaysia.
134. BankKerjasamaRakyatMalaysiaBerhad.
135. SyarikatTakaful Malaysia Berhad.
136. BPMalaysiaSdn.Bhd.
137. SetiausahaKerajaanJohor.
138. HongLeongBankBerhad.
139. AmanahFinanceMalaysiaBerhad.
140. SimeFinance Berhad.
141. RHBBankBerhad.
142. KoperasiMajlisAgamaIslamMelakaBerhad.
143. PembiayaanPerumahanNasionalSdn.Bhd.(PPN).
144. CreditCorporation(Malaysia)Berhad.
145. PerdanaFinanceBerhad.
146. PengurusanDanaharta NasionalBerhad.
147. BBMBSecuritiesSdn.Bhd.
148. HSBCBankMalaysiaBerhad.
149. LembagaTabungHaji.
150. DanahartaManagersSdn.Bhd.
151. DanahartaUrusSdn.Bhd.
109National Land Code (Penang and Malacca Titles) 152. BankIndustriMalaysiaBerhad.
153. MalaysiaAssuranceAllianceBerhad.
154. MalaysiaAirportsSdn.Bhd.
155. AmanahGeneralInsuranceBerhad.
156. BankMuamalat Malaysia Berhad.
157. Bumiputra-CommerceBankBerhad.
158. MultiPurposeBankBerhad.
159. Asia CommercialFinance(M)Sdn.Bhd.
160. KualaLumpurStock Exchange.
161. BankPembangunanDanInfrastrukturMalaysiaBerhad(BPIMB). 162. SetiausahaKerajaanNegeriSelangor(Pemerbadanan). 163. AffinBankBerhad.
164. AllianceBankMalaysiaBerhad.
165. Arab-MalaysianAssuranceBerhad.
166. PertubuhanKeselamatanSocial(PERKESO).
167. Bank NegaraMalaysia.
168. SouthernFinanceBerhad.
169. KoperasiGuru-GuruMelayuKedahBerhad.
170. AmBankBerhad.
171. AmFinanceBerhad.
172. Affin-ACFFinanceBerhad.
173. CreditGuaranteeCorporationMalaysiaBerhad.
174. LembagaTabungAngkatanTentera.
175. PembangunanSumberManusiaBerhad.
176. CagamasMBSBerhad.
177. SuruhanjayaSyarikatMalaysia.
178. SyarikatPerumahanNegaraBerhad.
179. RHBIslamicBank Berhad.
sEVENth schEduLE
[Sections108and109B]
PERSONSTOWHOMOR BODIESTOWHICHLANDSUBJECT
TO PARTVIIIMAYBETRANSFERREDORDISPOSED OF
1. YayasanMelaka.
2. SetiausahaKerajaanMelaka.
3. PerbadananPembangunanBandar.
110 Laws of Malaysia Act 518
4. PembangunanPertanianMelakaSdn.Bhd.
5. PerbadananKemajuanNegeriMelaka.
6. MajlisAgamaIslam Melaka.
7. MajlisAmanahRakyat.
8. Federal LandsCommissioner.
9. KoperasiWanita MelakaBerhad.
10. KompleksKewanganMalaysia.
11. PETRONASPenapisan(Melaka)Sdn.Bhd.
12. PETMAL Sdn.Bhd.
13. PETRONASDaganganSdn.Bhd.
14. KoperasiPekerja-PekerjaMelayuMelakaBhd.
15. KoperasiHomeopathyMelakaBhd.
16. EONPropertiesSdn.Bhd.
17. BankPertanianMalaysia.
18. ShapaduKontena Sdn.Bhd.
19. LembagaKebajikanPerempuanIslamPerhubunganNegeriMelaka. 20. PerbadananKemajuanTanahAdatMelaka.
21. SyarikatKerjasamaSerbagunaSungaiRambaiBerhad. 22. PetronasDaganganBerhad.
23. Syarikat Kerjasama Serbaguna Guru-Guru Ugama Negeri Melaka Berhad.
24. PersatuanNelayan KawasanMelaka.
25. BankIslamMalaysiaBerhad.
26. KoperasiPolisDiRajaMalaysia Berhad.
27. KoperasiPekebunKecilNegeriMelaka.
28. PertubuhanPeladang Kawasan MasjidTanah.
29. KetuaMenteriMelaka.
30. PertubuhanPeladangKawasanMelakaTengah.
31. KoperasiMajlisAgamaIslamMelaka.
32. PembangunanPembinaanMelakaSdn.Bhd.
33. TenagaNasionalBerhad.
34. KoperasiMajlisAgama IslamMelakaBerhad.
35. Pengurusan DanahartaNasionalBerhad.
36. PerbadananAirMelaka.
111National Land Code (Penang and Malacca Titles) 37. DanahartaManagersSdn.Bhd.
38. DanahartaUrusSdn.Bhd.
39. PertubuhanPeladangKawasanMerlimau.
40. KoperasiMajueraMelakaBerhad.
41. Bank NegaraMalaysia.
42. LembagaTabungAngkatanTentera.
43. Majlis BandarayaMelaka Bersejarah.
112 Laws of Malaysia Act 518
LAWS OF MALAYSIA
Act 518
NATIONAL LAND CODE (PENANG AND MALACCA
TITLES) ACT 1963
LISTOFAMENDMENTS
Amendinglaw Shorttitle Inforcefrom
Act55/1965 NationalLandCode(Penangand 01-01-1966 MalaccaTitles)(Amendment)Act
1965
Act11/1968 NationalLandCode(Penangand 04-04-1968 MalaccaTitles)(Amendment)Act
1968
ActA113 NationalLandCode(Penangand 04-04-1972
MalaccaTitles)(Amendment)Act
1972
ActA385 National LandCode(Penangand 18-03-1977
MalaccaTitles)(Amendment)Act
1977
ActA597 NationalLandCode(Penang 07-09-1984
andMalaccaTitles)(Amendment)
Act1984
ActA649 NationalLandCode(Penangand 16-05-1986
MalaccaTitles)(Amendment)Act
1986
ActA731 National LandCode(Penangand 05-05-1989
MalaccaTitles)(Amendment)Act
1989
ActA829 NationalLandCode(Penangand 17-07-1992
MalaccaTitles)(Amendment)Act
1992
113National Land Code (Penang and Malacca Titles) LAW OF MALAYSIA
Act 518
NATIONAL LAND CODE (PENANG AND MALACCA
TITLES) ACT 1963
AMENDMENTTOSIXTHANDSEVENTHSCHEDULES
Amending Law Shorttitle Inforcefrom
MalaccaP.U.24/1984 National LandCodeAct(Penang 01-01-1985 andMalaccaTitles)Order1984
MalaccaP.U.9/1985 NationalLandCodeAct(Penang 13-09-1985 andMalaccaTitles)Order1985
MalaccaP.U.4/1986 NationalLandCodeAct(Penang 11-04-1986 andMalaccaTitles)Order1986
MalaccaP.U.7/1986 NationalLandCodeAct(Penang 05-06-1986 andMalaccaTitles)Order1986
MalaccaP.U.9/1986 NationalLandCodeAct(Penang 26-09-1986 andMalaccaTitles)Order1986
MalaccaP.U.10/1986 NationalLandCodeAct(Penang 21-11-1986 andMalaccaTitles)Order1986
MalaccaP.U.11/1986 NationalLandCodeAct(Penang 21-11-1986 andMalaccaTitles)Order1986
MalaccaP.U.15/1986 NationalLandCodeAct(Penang 26-12-1986 andMalaccaTitles)Order1986
MalaccaP.U.3/1987 NationalLandCodeAct(Penang 27-02-1987 andMalaccaTitles)Order1987
MalaccaP.U.4/1987 NationalLandCodeAct(Penang 24-04-1987 andMalaccaTitles)Order1987
MalaccaP.U.5/1987 NationalLandCodeAct(Penang 03-07-1987 andMalaccaTitles)Order1987
MalaccaP.U.9/1987 NationalLandCodeAct(Penang 28-08-1987 andMalaccaTitles)Order1987
MalaccaP.U.10/1987 NationalLandCodeAct(Penang 28-08-1987 andMalaccaTitles)Order1987
114 Laws of Malaysia Act 518
Amending Law Shorttitle Inforcefrom
MalaccaP.U.14/1987 National LandCodeAct(Penang 06-11-1987 andMalaccaTitles)Order1987
MalaccaP.U.3/1988 NationalLandCodeAct(Penang 04-03-1988 andMalaccaTitles)Order1988
MalaccaP.U.15/1988 NationalLandCodeAct(Penang 22-07-1988 andMalaccaTitles)Order1988
MalaccaP.U.16/1988 NationalLandCodeAct(Penang 02-09-1988 andMalaccaTitles)Order1988
MalaccaP.U.37/1989 NationalLandCodeAct(Penang 10-11-1989 andMalaccaTitles)Order1989
MalaccaP.U.38/1989 NationalLandCodeAct(Penang 22-12-1989 andMalaccaTitles)Order1989
MalaccaP.U.7/1990 NationalLandCodeAct(Penang 02-03-1990 andMalaccaTitles)Order1990
MalaccaP.U.8/1990 NationalLandCodeAct(Penang 02-03-1990 andMalaccaTitles)Order1990
MalaccaP.U.20/1990 NationalLandCodeAct(Penang 08-06-1990 andMalaccaTitles)Order1990
MalaccaP.U.1/1991 NationalLandCodeAct(Penang 15-03-1991 andMalaccaTitles)Order1991
MalaccaP.U.13/1991 NationalLandCodeAct(Penang 19-07-1991 andMalaccaTitles)Order1991
MalaccaP.U.14/1991 NationalLandCodeAct(Penang 13-09-1991 andMalaccaTitles)Order1991
MalaccaP.U.22/1991 NationalLandCodeAct(Penang 22-11-1991 andMalaccaTitles)Order1991
MalaccaP.U.23/1991 NationalLandCodeAct(Penang 22-11-1991 andMalaccaTitles)Order1991
MalaccaP.U.21/1992 NationalLandCodeAct(Penang 31-07-1992 andMalaccaTitles)Order1992
MalaccaP.U.22/1992 NationalLandCodeAct(Penang 31-07-1992 andMalaccaTitles)Order1992
MalaccaP.U.23/1992 NationalLandCodeAct(Penang 18-12-1992 andMalaccaTitles)Order1992
115National Land Code (Penang and Malacca Titles) MalaccaP.U.1/1993 NationalLandCodeAct(Penang 05-02-1993 andMalaccaTitles)Order1993
MalaccaP.U.4/1993 NationalLandCodeAct(Penang 02-12-1993 andMalaccaTitles)Order1993
MalaccaP.U.7/1993 NationalLandCodeAct(Penang 23-07-1993 andMalaccaTitles)Order1992
MalaccaP.U.8/1993 NationalLandCodeAct(Penang 23-07-1993 andMalaccaTitles)Order1992
MalaccaP.U.9/1993 NationalLandCodeAct(Penang 23-07-1993 andMalaccaTitles)Order1992
MalaccaP.U.14/1993 NationalLandCodeAct(Penang 01-10-1993 andMalaccaTitles)Order1993
MalaccaP.U.18/1993 NationalLandCodeAct(Penang 24-12-1993 andMalaccaTitles)Order1993
MalaccaP.U.2/1994 NationalLandCodeAct(Penang 18-03-1994 andMalaccaTitles)Order1993
MalaccaP.U.3/1994 NationalLandCodeAct(Penang 18-03-1994 andMalaccaTitles)Order1993
MalaccaP.U.7/1994 NationalLandCodeAct(Penang 27-05-1994 andMalaccaTitles)Order1994
MalaccaP.U.11/1994 NationalLandCodeAct(Penang 22-07-1994 andMalaccaTitles)Order1994
MalaccaP.U.15/1994 NationalLandCodeAct(Penang 19-08-1994 andMalaccaTitles)Order1994
MalaccaP.U.24/1994 NationalLandCodeAct(Penang 14-10-1994 andMalaccaTitles)Order1994
MalaccaP.U.25/1994 NationalLandCodeAct(Penang 14-10-1994 andMalaccaTitles)Order19894
MalaccaP.U.1/1995 NationalLandCode(Penang 17-02-1995 andMalaccaTitles)Order1995
MalaccaP.U.2/1995 NationalLandCode(Penang 31-03-1995 andMalaccaTitles)Order1995
MalaccaP.U.5/1995 NationalLandCode(Penang 04-08-1995 andMalaccaTitles)Order1995
Amending Law Shorttitle Inforcefrom
116 Laws of Malaysia Act 518
MalaccaP.U.8/1995 NationalLandCode(Penang 24-11-1995 andMalaccaTitles)(No.4)
Order1995
MalaccaP.U.3/1996 NationalLandCode(Penang 02-08-1996 andMalaccaTitles)Order1996
MalaccaP.U.5/1996 NationalLandCode(Penang 30-08-1996 andMalaccaTitles)(No.2)
Order1996
MalaccaP.U.1/1997 NationalLandCode(Penang 31-01-1997 andMalaccaTitles)Order1997
MalaccaP.U.2/1997 NationalLandCode(Penang 31-01-1997 andMalaccaTitles)(No.2)
Order1997
MalaccaP.U.8/1997 NationalLandCode(Penang 26-09-1997 andMalaccaTitles)Order1997
MalaccaP.U.9/1997 NationalLandCode(Penang 26-09-1997 andMalaccaTitles)Order1997
MalaccaP.U.1/1998 NationalLandCode(Penang 16-01-1998 andMalaccaTitles)Order1998
MalaccaP.U.2/1998 NationalLandCode(Penang 27-03-1998 andMalaccaTitles)Order1998
MalaccaP.U.4/1998 NationalLandCode(Penang 05-06-1998 andMalaccaTitles)Order1998
MalaccaP.U.5/1998 NationalLandCode(Penang 05-06-1998 andMalaccaTitles)Order1998
MalaccaP.U.6/1998 NationalLandCode(Penang 31-07-1998 andMalaccaTitles)Order1998
MalaccaP.U.7/1998 NationalLandCode (Penang 31-07-1998 andMalaccaTitles)Order1998
MalaccaP.U.10/1998 NationalLandCode(Penang 11-09-1998 andMalaccaTitles)Order1998
MalaccaP.U.1/1999 NationalLandCode(Penang 05-03-1999 andMalaccaTitles)Order1999
MalaccaP.U.2/1999 NationalLandCode(Penang 05-03-1999 andMalaccaTitles)(No.2)
Order1999
Amending Law Shorttitle Inforcefrom
117National Land Code (Penang and Malacca Titles) MalaccaP.U.6/1999 NationalLandCode(Penang 16-04-1999 andMalaccaTitles)(No.3)
Order1999
MalaccaP.U.19/1999 NationalLandCode(Penang 26-11-1999 andMalaccaTitles)(No.4)
Order1999
MalaccaP.U.20/1999 NationalLandCode(Penang 26-11-1999 andMalaccaTitles)(No.5)
Order1999
MalaccaP.U.10/2000 NationalLandCode(Penang 17-03-2000 andMalaccaTitles)Order2000
MalaccaP.U.15/2000 Corrigendum:Malacca 07-07-2000 P.U.10/2000
MalaccaP.U.20/2000 NationalLandCode(Penang 24-11-2000 andMalaccaTitles)Order2000
MalaccaP.U. 21/2000 NationalLandCode(Penang 24-11-2000 andMalaccaTitles)Order2000
MalaccaP.U. 4/2001 NationalLandCode(Penang 13-04-2000 andMalaccaTitles)Order2000
MalaccaP.U. 7/2001 NationalLandCode(Penang 13-04-2000 andMalaccaTitles)Order2001
MalaccaP.U. 23/2002 NationalLandCode(Penang 11-10-2002 andMalaccaTitles)Order2000
MalaccaP.U. 25/2002 NationalLandCode(Penang 25-10-2002 andMalaccaTitles)Order2002
MalaccaP.U. 26/2002 NationalLandCode(Penang 25-10-2002 andMalaccaTitles)Order2002
MalaccaP.U. 5/2003 NationalLandCode(Penang 14-03-2003 andMalaccaTitles)Order2003
MalaccaP.U. 23/2003 NationalLandCode(Penang 27-06-2003 andMalaccaTitles)Order2003
MalaccaP.U. 24/2003 NationalLandCode(Penang 08-08-2003 andMalaccaTitles)Order2003
MalaccaP.U. 25/2003 NationalLandCode(Penang 08-08-2003 andMalaccaTitles)Order2003
AmendingLaw Shorttitle Inforcefrom
118 Laws of Malaysia Act 518
Amending Law Shorttitle Inforcefrom
MalaccaP.U.35/2003 National LandCode(Penang 14-11-2003 andMalaccaTitles)Order2003
MalaccaP.U.36/2003 NationalLandCode(Penang 14-11-2003 andMalaccaTitles)Order2003
MalaccaP.U.23/2004 NationalLandCode(Penang 13-08-2004 andMalaccaTitles)Order2004
MalaccaP.U.32/2004 NationalLandCode(Penang 17-12-2004 andMalaccaTitles)Order2004
MalaccaP.U.25/2005 NationalLandCode(Penang 01-07-2005 andMalaccaTitles)Order2005
MalaccaP.U.28/2005 NationalLandCode(Penang 22-07-2005 andMalaccaTitles)Order2005
MalaccaP.U.41/2005 NationalLandCode(Penang 30-09-2005 andMalaccaTitles)Order2005
MalaccaP.U.46/2005 NationalLandCode(Penang 30-12-2005 andMalaccaTitles)Order2005
MalaccaP.U.47/2005 Corrigendum:Malacca 30-12-2005 P.U.26/2002
MalaccaP.U.48/2005 Corrigendum:Malacca 30-12-2005 P.U.25/2003
MalaccaP.U.49/2005 Corrigendum:Malacca 30-12-2005 P.U.36/2003
119National Land Code (Penang and Malacca Titles) LAWS OF MALAYSIA
Act 518
NATIONAL LAND CODE (PENANG AND MALACCA
TITLES) ACT 1963
LISTOFSECTIONSAMENDED
Section Amendingauthority Inforcefrom
4 Act55/1965 01-01-1966
5 Act55/1965 01-01-1966
6 Act55/1965 01-01-1966
ActA113 04-04-1972
9 Act55/1965 01-01-1966
10 Act55/1965 01-01-1966
23 Act55/1965 01-01-1966
HeadingofPartIII Act55/1965 01-01-1966
25 Act55/1965 01-01-1966
30 Act55/1965 01-01-1966
HeadingofChapter Act55/1965 01-01-1966
3ofPartIII
31 Act55/1965 01-01-1966
Act11/1968 04-04-1968
33 Act55/1965 01-01-1966
34 Act11/1968 04-04-1968
35 Act55/1965 01-01-1966
36 Act55/1965 01-01-1966
37 Act55/1965 01-01-1966
39 Act55/1965 01-01-1966
40 Act55/1965 01-01-1966
41 Act55/1965 01-01-1966
42 Act55/1965 01-01-1966
43 Act55/1965 01-01-1966
45 Act55/1965 01-01-1966
46 Act55/1965 01-01-1966
120 Laws of Malaysia Act 518
49 Act55/1965 01-01-1966
51 Act55/1965 01-01-1966
52 Act55/1965 01-01-1966
53 Act11/1968 04-04-1968
58 Act55/1965 01-01-1966
62 Act55/1965 01-01-1966
63 Act55/1965 01-01-1966
68 Act55/1965 01-01-1966
71 Act55/1965 01-01-1966
72 Act55/1965 01-01-1966
73 Act55/1965 01-01-1966
74 Act55/1965 01-01-1966
75 Act55/1965 01-01-1966
76 Act55/1965 01-01-1966
77 Act55/1965 01-01-1966
78 Act55/1965 01-01-1966
80 Act55/1965 01-01-1966
81 Act55/1965 01-01-1966
82 Act55/1965 01-01-1966
83 Act55/1965 01-01-1966
84 Act11/1968 04-04-1968
85 Act55/1965 01-01-1966
Act11/1968 04-04-1968
87 Act55/1965 01-01-1966
88 Act55/1965 01-01-1966
ActA385 18-03-1977
89 Act55/1965 01-01-1966
90 Act55/1965 01-01-1966
92 Act55/1965 01-01-1966
93 Act55/1965 01-01-1966
Act11/1968 04-04-1968
PartVIII ActA597 07-09-1984
ActA649 16-05-1986
94 Act55/1965 01-01-1966
ActA597 07-09-1984
ActA649 16-05-1986
ActA731 05-05-1989
Section Amendingauthority Inforcefrom
121National Land Code (Penang and Malacca Titles) 97 Act55/1965 01-01-1966
ActA649 16-05-1989
99 Act55/1965 01-01-1966
Act11/1968 04-04-1968
101 Act55/1965 01-01-1966
ActA597 07-09-1984
102 Act55/1965 01-01-1966
Act11/1968 04-04-1968
103 Act55/1965 01-01-1966
104 Act55/1965 01-01-1966
ActA597 07-09-1984
ActA649 16-05-1986
105 Act55/1965 01-01-1966
107 Act55/1965 01-01-1966
108 ActA597 07-09-1984
ActA649 16-05-1986
ActA829 17-07-1992
108a-108d ActA649 16-05-1986
109 ActA597 07-09-1984
ActA649 16-05-1986
109a-109c ActA649 16-05-1986
110 Act55/1965 01-01-1966
111 Act55/1965 01-01-1966
112 Act55/1965 01-01-1966
114 Act55/1965 01-01-1966
115 Act55/1965 01-01-1966
117 Act55/1965 01-01-1966
118 Act55/1965 01-01-1966
119 Act55/1965 01-01-1966
120 Act55/1965 01-01-1966
121 Act55/1965 01-01-1966
ActA11/1968 04-04-1968
122 Act55/1965 01-01-1966
123 Act55/1965 01-01-1966
124 Act55/1965 01-01-1966
ActA11/1968 04-04-1968
Amending law Shorttitle Inforcefrom
122 Laws of Malaysia Act 518
Amendinglaw Shorttitle Inforcefrom
FirstSchedule ActA55/1965 01-01-1966
Act11/1968 04-04-1968
ActA649 16-05-1986
SecondSchedule Act55/1965 01-01-1966
ThirdSchedule Act55/1965 01-01-1966
FourthSchedule Act55/1965 01-01-1966
FifthSchedule Act55/1965 01-01-1966
SixthScheduleand Act55/1965 01-01-1966
SeventhSchedule ActA597 07-09-1984
ActA649 16-05-1986
M.P.U.24/1984 01-01-1985
M.P.U.9/1985 13-09-1985
M.P.U.4/1986 11-04-1986
M.P.U.7/1986 05-06-1986
M.P.U.9/1986 26-09-1986
M.P.U.10/1986 21-11-1986
M.P.U.11/1986 21-11-1986
M.P.U.15/1986 26-12-1986
M.P.U.3/1987 27-02-1987
M.P.U.4/1987 24-04-1987
M.P.U.5/1987 03-07-1987
M.P.U.9/1987 28-08-1987
M.P.U.10/1987 28-08-1987
M.P.U.14/1987 06-11-1987
M.P.U.3/1988 04-03-1988
M.P.U.15/1988 22-07-1988
M.P.U.16/1988 02-09-1988
M.P.U.37/1989 10-11-1989
M.P.U.38/1989 22-12-1989
M.P.U.7/1990 02-03-1990
M.P.U.8/1990 02-03-1990
M.P.U.20/1990 08-06-1990
M.P.U.1/1991 15-03-1991
M.P.U.13/1991 19-07-1991
M.P.U.14/1991 13-09-1991
M.P.U.22/1991 22-11-1991
M.P.U.23/1991 22-11-1991
M.P.U.21/1992 31-07-1992
M.P.U.22/1992 31-07-1992
M.P.U.23/1992 18-12-1992
M.P.U.1/1993 05-02-1993
M.P.U.4/1993 02-12-1993
M.P.U.7/1993 23-07-1993
M.P.U.8/1993 23-07-1993
M.P.U.9/1993 23-07-1993
M.P.U.14/1993 01-10-1993
M.P.U.18/1993 24-12-1993
M.P.U.2/1994 18-03-1994
M.P.U.3/1994 18-03-1994
M.P.U.7/1994 27-05-1994
123National Land Code (Penang and Malacca Titles) M.P.U.11/1994 22-07-1994
M.P.U.15/1994 19-08-1994
M.P.U.24/1994 14-10-1994
M.P.U.25/1994 14-10-1994
M.P.U.1/1995 17-02-1995
M.P.U.2/1995 31-03-1995
M.P.U.5/1995 04-18-1995
M.P.U.8/1995 24-11-1995
M.P.U.3/1996 02-08-1996
M.P.U.5/1996 30-08-1996
M.P.U.1/1997 31-01-1997
M.P.U.2/1997 31-01-1997
M.P.U.8/1997 26-09-1997
M.P.U.9/1997 26-09-1997
M.P.U.1/1998 16-01-1998
M.P.U.2/1998 27-03-1998
M.P.U.4/1998 05-06-1998
M.P.U.5/1998 05-06-1998
M.P.U.6/1998 31-07-1998
M.P.U.7/1998 31-07-1998
M.P.U.10/1998 11-09-1998
M.P.U.1/1999 05-03-1999
M.P.U.2/1999 05-03-1999
M.P.U.6/1999 16-04-1999
M.P.U.19/1999 26-11-1999
M.P.U.20/1999 26-11-1999
M.P.U.10/2000 17-03-2000
M.P.U.15/2000 07-07-2000
M.P.U.20/2000 24-11-2000
M.P.U.21/2000 24-11-2000
M.P.U.4/2001 13-04-2000
M.P.U.7/2001 13-04-2001
M.P.U.23/2002 11-10-2002
M.P.U.25/2002 25-10-2002
M.P.U.26/2002 25-10-2002
M.P.U.5/2003 14-03-2003
M.P.U.23/2003 27-06-2003
M.P.U.24/2003 08-08-2003
M.P.U.25/2003 08-08-2003
M.P.U.35/2003 14-11-2003
M.P.U.36/2003 14-11-2003
M.P.U.23/2004 13-08-2004
M.P.U.32/2004 17-12-2004
M.P.U.25/2005 01-07-2005
M.P.U.28/2005 22-07-2005
M.P.U.41/2005 30-09-2005
M.P.U.46/2005 30-12-2005
M.P.U.47/2005 30-12-2005
M.P.U.48/2005 30-12-2005
M.P.U.49/2005 30-12-2005
Amending law Shorttitle Inforcefrom
CommonLII:
Copyright Policy
|
Disclaimers
|
Privacy Policy
|
Feedback
URL: http://www.commonlii.org/my/legis/consol_act/nlcamta19631994397